[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64389.1


[Show Plain Result]

## Summary of Sequence Search
   1::667
 189::509    5e-42 34.5% 0046841 00468411 1/2   airpin glycosidases                     
 189::572  4.5e-29 28.5% 0048326 00483261 1/1   airpin glycosidases                     
  24::147    3e-22 29.6% 0049857 00498571 1/1   edoxin-like                             
  22::163  3.1e-22 29.2% 0042775 00427751 1/1   edoxin-like                             
  17::164  5.1e-22 29.3% 0049377 00493771 1/1   edoxin-like                             
 220::332    6e-13 32.7% 0051759 00517591 1/2   airpin glycosidases                     
  13::173  6.1e-13 28.3% 0051911 00519111 1/1   edoxin-like                             
  23::147  8.6e-13 31.8% 0046603 00466031 1/1   edoxin-like                             
  26::147  4.1e-12 31.2% 0048146 00481461 1/1   edoxin-like                             
  21::146  5.3e-12 28.7% 0049632 00496321 1/1   edoxin-like                             
  24::147  2.2e-11 31.2% 0051914 00519141 1/1   edoxin-like                             
  25::143  2.7e-11 35.3% 0049496 00494961 1/1   edoxin-like                             
 226::342  4.3e-11 33.3% 0050146 00501461 1/2   airpin glycosidases                     
  13::146  1.1e-10 29.8% 0050950 00509501 1/1   edoxin-like                             
  16::151  1.7e-10 29.2% 0049089 00490891 1/1   edoxin-like                             
  24::121    2e-10 34.1% 0049633 00496331 1/1   edoxin-like                             
  26::146  2.4e-10 30.8% 0049048 00490481 1/1   edoxin-like                             
  17::146  3.6e-10 30.6% 0046733 00467331 1/1   edoxin-like                             
  22::145    1e-09 31.4% 0053106 00531061 1/1   edoxin-like                             
  22::152  1.4e-09 29.8% 0045739 00457391 1/1   edoxin-like                             
  22::147  1.4e-09 22.6% 0051497 00514971 1/1   edoxin-like                             
  22::146  1.5e-09 28.0% 0046295 00462951 1/1   edoxin-like                             
  40::145  1.5e-09 35.2% 0051129 00511291 1/1   edoxin-like                             
  20::155  1.9e-09 29.1% 0039300 00393001 1/1   edoxin-like                             
  21::142  2.6e-09 27.7% 0050672 00506721 1/1   edoxin-like                             
  11::149  3.2e-09 27.3% 0040163 00401631 1/1   edoxin-like                             
  32::146  4.1e-09 26.5% 0039527 00395271 1/1   edoxin-like                             
  32::164  7.3e-09 33.0% 0053311 00533111 1/1   edoxin-like                             
  11::120    9e-09 27.6% 0050108 00501081 1/1   edoxin-like                             
  32::139  3.6e-08 33.3% 0040838 00408381 1/1   edoxin-like                             
  41::144    4e-08 34.1% 0048363 00483631 1/1   edoxin-like                             
  17::146  4.9e-08 23.7% 0043753 00437531 1/1   edoxin-like                             
  31::145    5e-08 31.6% 0037474 00374741 1/1   edoxin-like                             
  21::146  7.9e-08 29.0% 0046982 00469821 1/1   edoxin-like                             
  32::141  1.9e-07 32.4% 0048033 00480331 1/1   edoxin-like                             
  16::151  2.2e-07 27.4% 0042825 00428251 1/1   edoxin-like                             
  14::139  2.6e-07 26.5% 0041722 00417221 1/1   edoxin-like                             
  24::145  4.1e-07 32.4% 0051671 00516711 1/1   edoxin-like                             
  16::123  5.2e-07 27.5% 0043845 00438451 1/1   edoxin-like                             
 459::561    8e-07 31.2% 0050146 00501462 2/2   airpin glycosidases                     
  37::146  1.2e-06 30.3% 0051504 00515041 1/1   edoxin-like                             
  40::124  1.2e-06 32.9% 0037704 00377041 1/1   edoxin-like                             
  32::121  1.5e-06 32.9% 0051595 00515951 1/1   edoxin-like                             
  22::139  1.6e-06 28.2% 0052451 00524511 1/1   edoxin-like                             
  31::120    2e-06 28.4% 0048529 00485291 1/1   edoxin-like                             
  29::121  5.5e-06 34.6% 0045740 00457401 1/1   edoxin-like                             
  34::133  1.1e-05 26.9% 0047310 00473101 1/1   edoxin-like                             
  21::147  1.6e-05 22.1% 0052802 00528021 1/1   edoxin-like                             
  32::145  2.4e-05 26.9% 0052322 00523221 1/1   edoxin-like                             
  14::95   4.1e-05 31.6% 0052504 00525041 1/1   edoxin-like                             
  28::121  4.5e-05 30.5% 0039301 00393011 1/1   edoxin-like                             
  32::144  7.4e-05 25.8% 0051923 00519231 1/1   edoxin-like                             
  41::95   0.00011 40.4% 0043137 00431371 1/1   edoxin-like                             
 460::558  0.00011 31.9% 0051759 00517592 2/2   airpin glycosidases                     
  16::151  0.00057 23.0% 0036937 00369371 1/1   edoxin-like                             
  24::120   0.0007 29.2% 0035499 00354991 1/1   edoxin-like                             
 520::561    0.062 31.0% 0046841 00468412 2/2   airpin glycosidases                     
   1::667


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDARERCLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVA
00468411   1/2  ----------------------------------------------------------------------
00483261   1/1  ----------------------------------------------------------------------
00498571   1/1  -----------------------aegqpapdfvvlltldgfalaladlsgkpvlvdfwaswCgpCkalap
00427751   1/1  ---------------------nsvvielltdeefdealldasdkpvlvdFyapwCgpCkklapvl...ee
00493771   1/1  ----------------Llglaappvtlldl.gealelallsgkpvlvdfyapwCgpCkalapeleelaee
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  ------------Llslllgapapsfvvel.tgenfdelvlksgkpvlvdFyapwCgpCkalapvleelae
00466031   1/1  ----------------------dlsvieltglenfdlallkakaegkpvlvdfyapwCgpCkalapvl..
00481461   1/1  -------------------------dlPafsgavveltgenfdlalasgkpvlvdfyapwCgpCkalapv
00496321   1/1  --------------------sgpviel.tdenflelvllsgkpvlvdfwapwCgpCkalapvl...eela
00519141   1/1  -----------------------lsellalpdfsvveltgenfdlallegkpvlvdfyapwCgpCkalap
00494961   1/1  ------------------------svveltgeanfdlallegkpvlvdfyapwCgpCkalapvl...eel
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  ------------lllevgkpapdfsvvdld.enfdlavlkgkpvlvdfyapwCgpCkalapvl...eela
00490891   1/1  ---------------lslpaapdftvveltgenfdlallsgkpvlvdfyapwCgpCkalapvl...eela
00496331   1/1  -----------------------aegkpapdfsvveltgenfdlavlkgkpvlvdfwapwCgpCkalapv
00490481   1/1  -------------------------avieltgenfdlallkgkpvlvdfwapwCgpCkalapvl...eel
00467331   1/1  ----------------lgapapdvvlltldgfdelladlsgkpvlvdfyapwCgpCkalapvl...eela
00531061   1/1  ---------------------pvvvlltlenfdelladlsgkpvlvdfyapwCgpCkalapvl...eela
00457391   1/1  ---------------------lspvleltd.lnfldevlsdlsgkpvlvdfyapdwCgpCkalapvl...
00514971   1/1  ---------------------PdftlkdldgetvsladlkgkpvlvdfwatwCppCrae......lpale
00462951   1/1  ---------------------lsvveltg.enflslvllsgkpvlvdfwapwCgpCkalapvl...eela
00511291   1/1  ---------------------------------------aglpapdvvlltldgfdelladlsgkpvlvd
00393001   1/1  -------------------llldgnvkeltdenfeellksgkpvlvvfyapwCpyCkrlkpll...eela
00506721   1/1  --------------------lpavtlltldgfeealadlsgkpvlvdfwaskdeegeswCgpCkalapvl
00401631   1/1  ----------lllsllvgkpapdfslvdldgenfdlavlkgkpvlvdfwaswCgpCkalapvl...eela
00395271   1/1  -------------------------------kevslsdlkgkpvlvdfyatwCgpCkaeapel..eelak
00533111   1/1  -------------------------------efyalltgpkgvitewndilrakgilpeilvlleelldl
00501081   1/1  ----------llllllllalapevlllsleefeellkdlkgkpvvvdfwasddetgksWCppCkalaPvl
00408381   1/1  -------------------------------pviellsldffdevleslkgkpvlvdfyapwCgpCkala
00483631   1/1  ----------------------------------------lkPvlvdfyapwCppCkalkpll...eela
00437531   1/1  ----------------vgdpapdfeltdldgkevslsdlkgkpvlldfyaswCppCkteapel...eela
00374741   1/1  ------------------------------vleltddnflelvlksgkpvlvdfyapwCgpCkalapvl.
00469821   1/1  --------------------lpvvvlltlenfdelladlkgkpvlvdfwapwCgpCkalapvl...eela
00480331   1/1  -------------------------------etfdladlkgkpvlvdfwatwCppCkaeapvl...eela
00428251   1/1  ---------------lvgkpapdfslvdldgeefdlavlkgkpvlvdFyaswCgpCkalapvl...eela
00417221   1/1  -------------lllvgdpapvfeltdldgeevvlsdlkgkpvlvyFwaswCppCkalapvl...eela
00516711   1/1  -----------------------slPalpdftlvdldgetvsladlkgkpvlvdfyaswCppCkaeapel
00438451   1/1  ---------------llaplslevvleltldnfivlgakngkvvlvvFsdpwCpyCkrlepel..eelak
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  ------------------------------------lllllrlllllkslllllllllallvgdpapdft
00377041   1/1  ---------------------------------------sgklvvvvfyapwCphCkalkpll...eela
00515951   1/1  -------------------------------liellelvsvvklltleeleellksgkpvvvvfgapwCp
00524511   1/1  ---------------------sspvveltlenfdelvldsgkpvlvdfyapwCgpCkalapvl...eela
00485291   1/1  ------------------------------adlvlllldgnffelvllsgkpvlvdFwApWCgpCkaeap
00457401   1/1  ----------------------------ltdeefeelvknldgkpvvvvFyapwCpyCkalapll...ee
00473101   1/1  ---------------------------------Aevgdpapfslkdldgetlevslsdlkgkpvlvdfwa
00528021   1/1  --------------------lPapdftlvdldgetvslsdlkgkpvlvdfyaswCppCktelpal..eel
00523221   1/1  -------------------------------llsplllvgdpapdftlpdldGktvslsdlkGkvvlvvf
00525041   1/1  -------------lpllallllssgvveltdenfdellssdkpvlvdfwgdapwcgpCkalapvl...ee
00393011   1/1  ---------------------------eltdenfeelvlksgkpvvvvFyapwCpyCkalapll...eel
00519231   1/1  -------------------------------ktfsladlkgkpvlvnFwatwCppCkaelpel...eela
00431371   1/1  ----------------------------------------dklvlvdFyapwcgpckalapil...eela
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ---------------llallsllavveltldnfivlgaksgkvvlvvFsdpwCpyCkklkpvleelak..
00354991   1/1  -----------------------vellegkdfdvvlgsasgkpvlveFfapwCphCkalapvl...eela
00468412   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EFINKHFIPVKVDRDERPDVDRRLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEV
00468411   1/2  ----------------------------------------------------------------------
00483261   1/1  ----------------------------------------------------------------------
00498571   1/1  eleelaeeykll.dgvvvvkvdvddrpdengelakky....gvrgiPtlvlfdkdGkivaalryvGa...
00427751   1/1  laeelkdkvvfvkvdvdenpdlakky........gvrgiP.tllffkngkevdrlvgaldeeelleflek
00493771   1/1  yk.gnvvfvkvdvdrenpd........laqkygvrggliPtlvlfdkdGkvva.....ryvGaldaeell
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  eykglnkgvvfvkvdvdenp........akkf..gvrgiP.tlllfkdGkevd......pvryvGardae
00466031   1/1  .eelaeelkggvvfvkvdvdenpelakky........gvrgvPtlllfd.dGkev.....aryvGa.dae
00481461   1/1  leelaeeykglnkgvvfvkvdvdenpelakky........gvrgvPtlllfdnggkl.evaryvGaldae
00496321   1/1  kelkdgvvfvkvdvdenpelakky........gvrgiPtlllf.kdGkev.....aryvGaldaeellef
00519141   1/1  .vle..elaeelkgkgvvfvkvdvdenpelakky........gvrgvPtlllfd.dGkevallryvGa..
00494961   1/1  aeel.dgvvfvkvdvdenpelakky........gvrgiPtlllfd.nGkev..aryvGa.daeellefle
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  eelkg.vvfvkvdvdenpelakry........gvrgvPtlllfd.nGkeva.....ryvGa.daeellef
00490891   1/1  eel.pgvvfvkvdvdenpelakky........gvrgvPtlllfd.nGkev........aryvGa..daee
00496331   1/1  l...eelaeelkg.vvfvkvdvdenpelakky........gvrgiP.tlll-------------------
00490481   1/1  aeelkdgvvfvkvdvdenpelakky........gvrgiPtlllfd.dgkiv.....aryvGaldaeelle
00467331   1/1  eel.dgvvfvkvdvdlenpelakky........gvrgiPtlllfd.nGkev..aryvGa.daeellefle
00531061   1/1  eeykd.vvfvkvdvdenpelakky........gvrgiP.tlllfkdGkeva...rlvga...daeeleef
00457391   1/1  eelaeeykglgvvfvkvdvdenpelaeky........gvrgvPtlllfd.dGkevd.lryvGa...rdae
00514971   1/1  elaeegvvvvgvnvddspeavkaflkelglpfpvllldpdgelakaygvrgiPttflidkdGkivarlvg
00462951   1/1  eelkdgvvfvkvdvdenpelakky........gvrgiPtlllfd.dgkiv.....aryvGaldaeellef
00511291   1/1  fyapwCgpCkalapvl...eelaeelkdgvvfvkvdvdenpelakry........gvrgiPtlllfd.nG
00393001   1/1  eeypglkvvfvkvdvdenpelaeky........gvrgvPtlvlfk.nGkevg.......grfvGarslee
00506721   1/1  ...eelakeykdnvvvvkvdvdddeelldengelakky.gvrgiP.tll..kdGkev..arlvGaldaee
00401631   1/1  key..gvvvvkvdvddsaeevkeflkkyglpfpvllgdengelakky........gvrgiPtlflfdkdG
00395271   1/1  elkdkgvvvvgvdvdenspeelkaflkkfgltfplllgdvdgilagelakay........gvrgiPtlfl
00533111   1/1  alleglsllkliaekllekykleeldellddeedeefleeyregrleellkslplklsfgevieltteen
00501081   1/1  ...eelakeykddvvfvkvdvdenpvlkdpngelakk.ygvtgiPtllvf--------------------
00408381   1/1  pvl...eelaeeykd.vvfvkvdvdenpelaerygv........rgiPtlllf.knGkev..aryvGar-
00483631   1/1  aeykdgvvvvkvdvdenpe........laerygvrgvPtlli...dgkvv....vvgardleeleeflkk
00437531   1/1  eelkdkgvvvvgvsvddspeslkaflkkyglpfplladengelakay........gvlgiPtlflidkdG
00374741   1/1  ..eelaeeykggvvfvkvdvdenpelakryg........vrgiPtlllfk.ngkeva.....ryvGarda
00469821   1/1  eel.dgvvfvkvdvdenpelakky........gvrgiPtlllf.kdGkevaryv.....Ga.daeellef
00480331   1/1  eelk.gvvvvgvdvddnpealkkfleklglpfpllsdpdgalakaygvrg....iPttflidkdGkivar
00428251   1/1  eelkgekgvvvvkvdvdenrdtlkkflkklglpfpllldpdvikelakay........gvrgiPtlflfd
00417221   1/1  ekykdekgvvvvkvdvddnpeelkeflkklglpfpllldpdvlgelakayg........vrgiPtlvli-
00516711   1/1  ...eelaeel.dgvvvvgvsvd.......dspelakkflgvfglptfpllsdpggevaraygvlalpttf
00438451   1/1  eyvtvvvilfpllgeeslaaakaalilcakdkykalhdalfggalkseavkvd-----------------
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  lpdldgkvvslsdnFdelkgkpvlv.FfgllWCgpCkalapvl.e...laeelkdgvvvvkvdvdenpel
00377041   1/1  eelpgdvvfvkvdvdenpelaeky........gvrgvP.tlvifkngkyvgald----------------
00515951   1/1  yCrklapil..eelaeel...kvkfvkvdvdenelldeiqelaeky..gvr-------------------
00524511   1/1  keykdlglkgdvvfvkvdvd...........dlakkygvrgiPtlllfd.nGkevarlvytgartaeel-
00485291   1/1  ileelaeeykgkglvvlavsfllelkvvfvkvdvdenpelakkyg.....--------------------
00457401   1/1  laeeyklllngkvkfvkvdvdenpelaeky........gvrsvPtlvlfk.-------------------
00473101   1/1  twCppCkaeapel...eelaeelkeddgvvvvgvsvddspelakkfvegyptfplllsdgdvv-------
00528021   1/1  aeelkdkgvvvlgvsvdsfperdspeelkefleklgvlnfpllsdengelakay........gvlgiPtl
00523221   1/1  watwCppCkaelpeleelaeeykd..gvvvvgvsvndfgnqeddspeelaafaekygltfplllDedgev
00525041   1/1  lakelpgkgvklakvdvdenpelae---------------------------------------------
00393011   1/1  aaeykdlgkgkvkfvkvdvdenpelaeky........gvrsvPtivlfk.n-------------------
00519231   1/1  eeykdgvvvvgvnvdllgeedspealkkflkelgldfpvlldedgelakaygvrg........tPttfli
00431371   1/1  eeldgkvtlvkvdvdenpelaeeyg---------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ggvtvvyrpfplnglgpdsllaarailcaadqgkgldaaalgalldsaaakvdvdenqelaqkl..gvrg
00354991   1/1  eelpdkvkfvkvdvdllggpnsllaaraalaaaalgkflklhdalfeaqf--------------------
00468412   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLAALAASFDEEYGGFGGAPKFPPIT
00468411   1/2  ------------------------------------------------msmdllllpsledlleallesl
00483261   1/1  ------------------------------------------------kelldladgyyelladggdegk
00498571   1/1  ldaeell---------------------------------------------------------------
00427751   1/1  llelidiieevylgalkglvlvv-----------------------------------------------
00493771   1/1  eflekllellleiaellellleel----------------------------------------------
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  elleflekl.....gaedvdllllleallelll-------------------------------------
00466031   1/1  ellefle---------------------------------------------------------------
00481461   1/1  ellefle---------------------------------------------------------------
00496321   1/1  lekllk----------------------------------------------------------------
00519141   1/1  .ldaeel---------------------------------------------------------------
00494961   1/1  kl.-------------------------------------------------------------------
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  leklla----------------------------------------------------------------
00490891   1/1  lleflekllge-----------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  flkkll----------------------------------------------------------------
00467331   1/1  ...kll----------------------------------------------------------------
00531061   1/1  lekll-----------------------------------------------------------------
00457391   1/1  elleflekllgl----------------------------------------------------------
00514971   1/1  alda...---------------------------------------------------------------
00462951   1/1  lkkllk----------------------------------------------------------------
00511291   1/1  keva.-----------------------------------------------------------------
00393001   1/1  llellekllgvslll-------------------------------------------------------
00506721   1/1  le--------------------------------------------------------------------
00401631   1/1  kvv..aryv-------------------------------------------------------------
00395271   1/1  idkdGk----------------------------------------------------------------
00533111   1/1  fdelvkksk.kgkpvlvdFyapWC----------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  .ell------------------------------------------------------------------
00437531   1/1  kvvary----------------------------------------------------------------
00374741   1/1  eelle-----------------------------------------------------------------
00469821   1/1  lkkllk----------------------------------------------------------------
00480331   1/1  l---------------------------------------------------------------------
00428251   1/1  kdGkvv.....-----------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  lidpd-----------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  akkfle----------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  flidkdG---------------------------------------------------------------
00523221   1/1  akayg-----------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  dkdG------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  tPtlvif..nG-----------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QLELLMMRHFYDGVGIYGKMAERTLDAMALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYT
00468411   1/2  lpfwleagfdpenggfgenldddgkvldapkfpvpqdrqvwalavlyrlyertgdpealeladatldala
00483261   1/1  glfgpypwWttglalgalldlyeltgdpeyldlaekwldfllg...............pdgdwlvphfe.
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  ---------ltflreelrkwlletllpfwlgygvd.enggfferldddgkplphaekrlwlqarqlwafs
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  ---------------eallalelvlaki..ggnidrlgggfplystddgk.yptfekwlWtnGfwlgglw
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KAYRQFGKALYKRTAEGIVKWLDEFMRAPEGGYYASQDADVDGEEGGYYRWSLEELKELLGELYPVASKH
00468411   1/2  rggrydhlgggf.rysvdrdglvpdfekmlydnaflllalarayraTgdpkylelaektadwllrrlrdp
00483261   1/1  ..ddnaflllallaayeltgdpryldlaeeladyllsrfdteeGgfyswdd...................
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  layl.tgdpeylelaehgldfllrhlrdpehggwyfsldadg.pldttkyly------------------
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  llyeltgdekyleiaeewldslldrlgs.........dslidthdlgflyvlslialyeltg--------
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV
00468411   1/2  egGgfydaldads.ansgmhlaeallalyevtgegd........peyldrakkladwllerladelgped
00483261   1/1  .........................................................yddkiiidnngma
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GNKYHAVRTLERFGVELGQRGRLPRGFRGGGPVGIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEI
00468411   1/2  gllyegldedgkpl.lgareqrynpghdlewawllaeaarvtgdpeyleaAlerladfilkklwdpdtGg
00483261   1/1  ilalarlyrltgdpkyldlAekaadwilknlldpedgllyhgydfdgevrwqgtldgyskgfWargqgwl
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  --------------------------------------qgyaddstWaRGqawaiyGlaelyeatgdpky
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ---------------------------------------dqafvllAlaeayr.tgdpealelaeelfdf
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGK
00468411   1/2  lyysldrdgkagdpglldd---------------------------------------------------
00483261   1/1  lyglaelyeatgdsdplrekyldaakkladallkfqdpdgGgwyedld.dpdlpd.nyke.....tsaaa
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  letaeklaeallkrlpedgvwywdld....apddpgsyrD...sSAtaiaaygLlelarllpdkgllaee
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  iesrfwdpenGgyregld.......pdwseledyrnqnanmhlleaalalyeatgdpkyleraeklad--
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  -----------------------------fekmlydnaflllalarayraTgdpkylelaektadwllrr


                         -         -         -         *         -         -         -:630
query           MERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALRAYRPWHVVVPITGNWPYKDPAVRAMLNGPK
00468411   1/2  ----------------------------------------------------------------------
00483261   1/1  ifaygllrlarl----------------------------------------------------------
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  Y---------------------------------------------------------------------
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  l---------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           PAAYICAGGACSLPVREPERLEKTIEEFMKTKYALPL---------------------------------
00468411   1/2  ----------------------------------------------------------------------
00483261   1/1  ----------------------------------------------------------------------
00498571   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00517591   1/2  ----------------------------------------------------------------------
00519111   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00501461   1/2  ----------------------------------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00506721   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00533111   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00483631   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00501462   2/2  ----------------------------------------------------------------------
00515041   1/1  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00525041   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00431371   1/1  ----------------------------------------------------------------------
00517592   2/2  ----------------------------------------------------------------------
00369371   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00468412   2/2  ----------------------------------------------------------------------