[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64489.1


[Show Plain Result]

## Summary of Sequence Search
   1::816
  41::678 3.5e-138 33.6% 0040209 00402091 1/1   te dehydrogenase/DMSO reductase, domain 
  43::684 2.8e-131 33.1% 0044013 00440131 1/1   te dehydrogenase/DMSO reductase, domain 
  43::573 1.4e-129 36.7% 0042561 00425611 1/1   te dehydrogenase/DMSO reductase, domain 
  43::666 3.1e-126 34.9% 0045382 00453821 1/1   te dehydrogenase/DMSO reductase, domain 
  44::696 8.3e-124 34.5% 0044058 00440581 1/1   te dehydrogenase/DMSO reductase, domain 
  42::672 1.3e-120 33.3% 0041852 00418521 1/1   te dehydrogenase/DMSO reductase, domain 
  32::668 4.9e-119 31.8% 0037989 00379891 1/1   te dehydrogenase/DMSO reductase, domain 
  45::677 6.1e-119 34.7% 0036504 00365041 1/1   te dehydrogenase/DMSO reductase, domain 
  44::696 1.1e-117 33.2% 0037183 00371831 1/1   te dehydrogenase/DMSO reductase, domain 
  42::670 2.5e-110 33.5% 0053129 00531291 1/1   te dehydrogenase/DMSO reductase, domain 
  42::605  7.7e-77 33.7% 0052772 00527721 1/1   te dehydrogenase/DMSO reductase, domain 
  33::705  3.5e-65 27.2% 0038360 00383601 1/1   te dehydrogenase/DMSO reductase, domain 
 650::816  3.2e-20 33.3% 0047096 00470961 1/1   ike                                     
 680::814  1.3e-19 31.0% 0042560 00425601 1/1   ike                                     
 674::816    1e-17 33.1% 0046942 00469421 1/1   ike                                     
 681::816  3.1e-17 28.8% 0045381 00453811 1/1   ike                                     
 690::816  2.9e-16 32.0% 0049634 00496341 1/1   ike                                     
 681::816    9e-16 29.7% 0053128 00531281 1/1   ike                                     
 680::816  3.2e-15 27.8% 0046362 00463621 1/1   ike                                     
 680::816  4.4e-15 27.1% 0046625 00466251 1/1   ike                                     
 657::800  5.5e-14 32.1% 0047857 00478571 1/1   ike                                     
 678::815  5.5e-14 27.9% 0049658 00496581 1/1   ike                                     
 685::815  1.3e-13 26.1% 0041851 00418511 1/1   ike                                     
   1::816


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTNLSRREFGKLVVTTALVSSSVAALKPLFEAKSAQVTQTGVEAVPITCAACGAACGLFFVRNGQRMYLL
00402091   1/1  ----------------------------------------fryrarawelkvvpstCpfCgvgCgilvyv
00440131   1/1  ------------------------------------------kvvrttCpyCgvgCgllvyvkdgkvvrv
00425611   1/1  ------------------------------------------asslvslgnlvdlcpvgaltskllafea
00453821   1/1  ------------------------------------------WdlkvvpsvcpfCgvgCgilvyvkdgkv
00440581   1/1  -------------------------------------------vvktvcpyCgvgCgllvyvkdgkivrv
00418521   1/1  -----------------------------------------lkvvpsvCpfCgvgCgilvyvkdgkvvri
00379891   1/1  -------------------------------GnvvplcpvgakvvrstCpfCgvgCgllvyvkdgkvvkp
00365041   1/1  --------------------------------------------vrstcpfCgvgcgailvyvkdgkvvr
00371831   1/1  -------------------------------------------vvktvcvfCgvgCilvyvkdgkvvrve
00531291   1/1  -----------------------------------------lkvvktvCpyCgvgcgllvtvedgkvvrv
00527721   1/1  -----------------------------------------WelkkvpsvCplCgvgCgilvevrdgkvv
00383601   1/1  --------------------------------avlelklleakvvktvCpyCgvGCgllvyvegkdgkvv
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
00402091   1/1  kdglvffetqkvvriegdpdhpvnegrlCakGralldylyspdRltyPlkRv..rgsgkfvrisWdeAld
00440131   1/1  epaffypapvpllpnleprgdpdhpvnrgrlCakGaalleyvyspdRlkyPlkRvgwlekgegykskRge
00425611   1/1  rpwellyrnrwshdkvvrstCpynCgvgCgllvyvkdGkvvrvegdtdypdtspdhpvnegrlCpKGasl
00453821   1/1  vrvegdpdhpnegrlCakgralldylyspdRltyPlirvg..gegkfvrisWdeAldliaeklkeireey
00440581   1/1  egdpdhpvnrgrlcakg....dyvyspdRlkyPlkRvgllegggkdykseRgegkfvrisWdeAldliae
00418521   1/1  egdpdhpvnegrlCakgrflydllyspdRltyPliRvgpkklRGegkfvrisWdeAldliaeklkairke
00379891   1/1  eafaadpvellltqsllalsidvldavgsnirvdsrglevlriegdpdhpvnegrlCaKgralldllydl
00365041   1/1  vegdpdhp..rlcakgaslldllyspdRlkyPliRvalleeggnskkgkrgdgkfvrisWdeAldliaek
00371831   1/1  gdpdhpvnegrlcakg....eylyspdRlkyPlkRvsllpeggnsdkgkrgdgkfvrisWdeAldliaek
00531291   1/1  egdp.hpvnrgrlCakgaallelvyspdleqgRltyPlkR.gprg.gkfveisWdeAldliaeklkeird
00527721   1/1  riegdpnhpvnegwlCdkgrfgydlly.pdRlttPlir....gdgkfveiswdeAldliaeklke....y
00383601   1/1  gvegdpdhPvnrGllCvKGafllelvnsedRltyPliRan..ggdkfeevsWdeAldliaeklkeirdey
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
00402091   1/1  liaeklkeirdeygpdaialfsgvgrmgllagygsgrasneeayllqrlaralGtnnidsharychapav
00440131   1/1  glgkldedpkfvrisWdeAldliaeklkeirkeygpdsiafysgsgrssneeayllqklarflnllGtnn
00425611   1/1  ldyvyspdRlkyPlkRknllelwreakgrledPveawasivedlekgksyvgeRGegkfvrisWdEAldl
00453821   1/1  gpdsiafygsggasneaayllqklaraalGtnnidsharlchapavaglaytfGsgavtnsledienadl
00440581   1/1  klkeirkeygpdsiafysgsgrlsneeayllqklaralglgtnnldshgrlchgaavaglpltfGslevl
00418521   1/1  ygpdsiafygsggatneeayllqkllravlGtnnldsharlchapavaalpltfGsgaptnsledienad
00379891   1/1  elespdRltyPlkR....gegkfvrisWdeAldliaeklkeirdeygpdsiafysygggsgglsneaayl
00365041   1/1  lkairkeygpdsiafysyggagsgrlsneeayllrklaraggyvlgtnnidsharlchspavaglaltfG
00371831   1/1  lkeirkeygpdsiafysyggagsgrlsneeayllrklaraggyllgtnnidsnarlchapavaglaltfG
00531291   1/1  eygpdsvafygsgrgtgneaayllqklaraalgtnnidsnarlchasavaglaltfGvgagtvsledlen
00527721   1/1  gpdsiafygsgrasneeayllqklaralGtnnldsnarlch..........lgggaltasledienadli
00383601   1/1  fvekneegllvngpdsvaflgsaqltneeaYllqKlaralgtnnidhnaR.llhssavaGlartfGagam
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AMGHIRRLTVAREKGVKVVVVDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
00402091   1/1  aalaltfGsgaptnsleDienadlillwGsNpaethpvlasrlreakkergakvivvdPrrtrtaaladl
00440131   1/1  ldtnarlchgsycagalavglpltfGsgagtnslkddlenadlillwGsnpaethpvllggpdahrllea
00425611   1/1  iaaklkeireeyGpdsiaffsgggatnevsylaqkrflnllGtnnldsnarsc..aavaalpytfGsgav
00453821   1/1  illwGsnpaethpvlalrlreakllkrgakvivvdPrrtrtaaladlwlpirpgtDaalllalahvliee
00440581   1/1  gamtnsledlenadlillwGsnpaethpvlalllslsllaglahrlleakkrgaklivvdPrrtetaall
00418521   1/1  lillwGsnpaethpvlalrlreaklskrgakvivvdPrrtrtaaladlwlpirpgtDaaLalalahvlie
00379891   1/1  lqklaraalGtnnidsnarlchasavagl.ltfGsgavtnsledienadlillwGsNpaethpvlflghl
00365041   1/1  vg..tnsledlenadlillwGsnpaethpvlftrirvpdalflreakkrgakvivvdPrrtrtaalladl
00371831   1/1  ..amtnsledlenadlillwGsnpaeshpvlfgvtrvpdalrlleakkrgakvivvdPrrtrtaalladl
00531291   1/1  adlillwGanpaeshpvllsrlleakkrgaklividPrrtetaaladlwlpirpgtDvaLllalahvlie
00527721   1/1  lliGnpaethpvlalrlrkakkrgallvaliglkedllydvlnlgldaklklvvvdPrrtetaalAdlhl
00383601   1/1  tnsydDlenadviliiGsNpaeaHPvlfsrlleakengaklivvDPrftrtaalAdlhlpirpgtDiall
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APFLIKPDGQPLTQKDLGQEGTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAER
00402091   1/1  wlpirpGtDaaLalalahvlieeglydkdFlarytngpflvildegfl........dglflgldeetgly
00440131   1/1  kkrgaklivvdPrrtetaalladlwlpirPgtDaaLalalahvlieeglydkdFlarytv..........
00425611   1/1  tnsyaDienadlillwGsNpaethpvlahrlleakkrGakvivvDPrrtetaakadlwlpirPGTDaALa
00453821   1/1  glydkdFlarytnapl.....................................................g
00440581   1/1  adlwlpirpgtDaaLllalahvlieeglydkdFlarytng..............................
00418521   1/1  eglydkdFvaeytnapflvgdlglfldgl..........................enfldyllgeyd..g
00379891   1/1  lpnlggatasellsrlleakkrgaklivvdPrrtrtaakadapqsplevlwlpirpGtDlalllglahvl
00365041   1/1  wlpirpgtDaaLllalahvlieeglydkdFlarytv..................................
00371831   1/1  wlpirpgtDaaLllalahvlieeglydkdFlarytn..................................
00531291   1/1  eglydkdflaeytvg.......................................................
00527721   1/1  pirPgtDaalllalahvl....................................................
00383601   1/1  ngllnyiienglidkefieertngsllvge........glrfedglfsgydeekrky..dksswayelde
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAKYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
00402091   1/1  vaak..wsylldallvalldgtlvkvktvfdllkaavapytpewaaeitGvpaetirelArefasaaltg
00440131   1/1  ....................................................gfdelkayvlgkddgvpy
00425611   1/1  lalahvlieeglyDknvpyfldFlrrytngfelvraderdggfedglflrasdlgdllgladnaewkllv
00453821   1/1  ldvptgfeelkeyllgytpewaaeitGvpaetirelarelasakraaiiwgmgltqhtngvqnvraianL
00440581   1/1  ................................fdelkayvagledgvpytpewaaeitGvpaedirelAr
00418521   1/1  vakvrtgfellkahvaeytpewaaeitGvpaetirelarelasakpkaaiiwgmgvtqhtngvqnvraia
00379891   1/1  ieeglydkdFvaeytv......................................................
00365041   1/1  ............................gfeelkeylaglddgvpytpewaaeitGvpaeqirelArlfa
00371831   1/1  ............................gfdelkayvagesdgvpytpewaaeitgvpaeeirelArefa
00531291   1/1  .......feelkayvlgytpewaaeitgvpaedirelarlyakakravilwgmgltqhtngtqtvraian
00527721   1/1  ................................................vpaetirelarllaaakralii
00383601   1/1  dglpkrdetlkdprcvfeelkehverytpekvaeitGvpaedllevaelyaeagkpdkaatilyamGvtQ
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
00402091   1/1  kraaiiwgmgltqhtngvqnvraianLalltGnigrpGgglfplrgqsnvqGardvgglpnllpgyldvp
00440131   1/1  tpewaaeitGvpaetirelArefakakraailwgmgllrgltqhtngtqtvraianLalltG.igkpGgg
00425611   1/1  ldeasgalvpvgslgarwgdvgkwnlelddledgealdlllslldasdevvevlfpyfdglgsellegll
00453821   1/1  alltGnigkpGgglfplrgqanvqgaardvgalpnllpgyldvpdpapralladlwgvplltlplkpglt
00440581   1/1  efaeakpailwgmgltqhtngtqnvraianLalltGnigrpGgglfplrgqsnvglplqgardvgglprl
00418521   1/1  nLalltGnigrpGgglnplrgqanvqgtardvgllpnllpgyldllnpaaralvaniwgaplgllplkpg
00379891   1/1  ........gfdelka.vapytpewaaeitGvpaedirelArlyaklktlkaakraailwgmgitqhtngv
00365041   1/1  skraaiiwgmgltqhtngvqnvraianLalltGnigrpGgglflglhyvgqekplrgqpnvqgardvg.l
00371831   1/1  sakpailwgmgvtqhtngtqnvraianLalltGnigrpGgglfplrgqsnvqgardrvgllpsalpgyln
00531291   1/1  LalltGnigrpGgglfplrghsnvqgardvgilpnllpgyllvldpalrdklervwglpalplepgltav
00527721   1/1  vgmgltqh........ianlalltgnigrpgggll....plrgqanvqgardlgllpallpgy.......
00383601   1/1  htvGtqnvralanlqLltGniGrpGgGvnaLrGqnnvqGatdvGllanllPgylgvpnpahralaeylwg
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PFHRDVNTEKLKKALQKLELIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
00402091   1/1  npehralveefwgvdlgqlrlgvlglpallnpvpvsllkawlpdalladlellfllllprkpgldaveal
00440131   1/1  lglsahyvgqvklllfplrgqsnvqgardmgalpnllpgylylanpkwrlleklwnvpkllipvar..il
00425611   1/1  ekglllrlvvlrgvpltdvggvlvrtvfdllkehygvdrgelgkdyllgyddvapytpewaaeitGvpae
00453821   1/1  avellealldgkikalfvlgtNplvslpdanrvrealekldlfvVvidifldtetalyAdvvLPaatwlE
00440581   1/1  lpgylgllnpewryevakgwlppaptldllplpgltavelilaledgdikalfvlggNplvsspdgnrvr
00418521   1/1  lnavealealedgkikalfvlgtNplvslpdanrlfvrealkkldfvVvidifltetalyADvvLPaatw
00379891   1/1  qnvraianLalltGnigrpGggvnplrgqsnvqgardvgglanllpgyl...lpearalledvwgvplpl
00365041   1/1  pnrlpgylnllnplareaarvpelplgpgltavealdaledgkikalfvlggNplvsspdgnrvlealek
00371831   1/1  vldeaaravaagwgipvayvvdlllkpgl..taaelieaalegkikalfvlggNplvsspdgnrvreale
00531291   1/1  eailalldgkikalivlggNpvvslpdtnrvrealekldfvVvidifltetalyAdlvLPaatwlErdgt
00527721   1/1  .....................pgkikalfvlganpv........vlealekldfvVvldiflteetalyA
00383601   1/1  vtpvtldplqanylsnllkflvsllkalygdaaleeaygllpkldpkpglsavelfdalldg.......k
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAFEHYEKKFFEAALRKLAETWKLDFEEIKEAL
00402091   1/1  ealedgkikalfvlgtNpvvslpdanrvrealrkldfvVvidifltetalyADnagelndvdpaeiktev
00440131   1/1  daalrpgypalyngftlpplpgldaveaieaalpgkikalwvlggNplvslpdlnrvrealldekldfvV
00425611   1/1  tIrelArefatna---------------------------------------------------------
00453821   1/1  kdgtv...tnserrvqlrrkavePpge..arsdweilaeLakrlglleea........fdyktleeilde
00440581   1/1  ealekldlvVvidifltetalyADivLPaatwlEkdglvvtvtnserrvqlrrkavePp..gearsdwei
00418521   1/1  lEkdgtv...tnserrvqlrrkavePpge..arsdweilaeLakrlgldgalplgildlvlftlgkdele
00379891   1/1  kpgltaveliealldgkikalwvlggnplvslpdanrvrealrkldlfvVvqdifltetalyADvvLPaa
00365041   1/1  ldlvVvidifltetalyADivLPaatwlEkdgtvtnveyserrvqlrrkavePpge..arsdweilaeLa
00371831   1/1  kldlvVvidifltetalyADivLPaatwlEkdgtvllltnserrvqlrrkavePpge..arsdweilaeL
00531291   1/1  vtnser...rvqlsrkvveppg..earsdweilaeLakrl........gldelftdgedifdeiaalt..
00527721   1/1  dvvLPaatflEkdg...tftnsegrvqlfrkaveppge..arsdw-------------------------
00383601   1/1  ikalyvmgenpvvslpnlnkvrealekldflVvqDlfltetAlfakrpdvdpeeiqtadvlLPaaswaEk
00470961   1/1  ----------------------------------------------------------------------
00425601   1/1  ----------------------------------------------------------------------
00469421   1/1  ----------------------------------------------------------------------
00453811   1/1  ----------------------------------------------------------------------
00496341   1/1  ----------------------------------------------------------------------
00531281   1/1  ----------------------------------------------------------------------
00463621   1/1  ----------------------------------------------------------------------
00466251   1/1  ----------------------------------------------------------------------
00478571   1/1  ----------------------------------------------------------------------
00496581   1/1  ----------------------------------------------------------------------
00418511   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           ERDGFYILKKKTYETRPYKTPLGTPSGKVEIYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNF
00402091   1/1  vvLPaatwlEkdgtv...tnserriqlrrpavePp..gearsdweila----------------------
00440131   1/1  vidifltetalyADivLPaatwlEkdglvtalglqlvevedslsnserriqlrr----------------
00425611   1/1  ----------------------------------------------------------------------
00453821   1/1  iaaliagdlpglagisleelkelgglqwpvpdgktl----------------------------------
00440581   1/1  laeLakrlgleea....fteglleyespeeifdeiaaliag...gldgisfeelke....lgglqw----
00418521   1/1  wlellyelvrdlalglvelldgktlelldyddpeeirdeiaa----------------------------
00379891   1/1  twlEkdgtv...tnserrvqlrrkavePpge..arsdw--------------------------------
00365041   1/1  krl........glefpyddpeeifdelaalvpeladlaralglsg.i-----------------------
00371831   1/1  akrl........gleeafddpeeifdelaaltpeladlnrllglsgisferlkelgglqwpvpaga----
00531291   1/1  ..........pglagltyerlrelggvqlpvpdllrledg------------------------------
00527721   1/1  ----------------------------------------------------------------------
00383601   1/1  e..Gtvtns.eRrvqwvrkavePpg..earpDleilvelakrlglllayeggeildeilkltpdyllven
00470961   1/1  -------------------lgfptpsgkaelyslll.....dplpahpeples.eepdeeyPlvlttgrl
00425601   1/1  -------------------------------------------------ppleppdkeyplvlttgrllw
00469421   1/1  -------------------------------------------lPvwaeppd....aeyplvlitgrlld
00453811   1/1  --------------------------------------------------paelldeeyplvlttgrlle
00496341   1/1  -----------------------------------------------------------eYPlvlitgrl
00531281   1/1  --------------------------------------------------Paelldeeyplvlttgrlle
00463621   1/1  -------------------------------------------------ppaelldeeyPlvlitgrlle
00466251   1/1  -------------------------------------------------ppleeldaeyplvlttgrlle
00478571   1/1  --------------------------gkielysltlglfgtpdgpalfvplepvppaelpdkeyplvltt
00496581   1/1  -----------------------------------------------leppaeepdkeyplvlitgrlre
00418511   1/1  ------------------------------------------------------ldeeyplvlttgrlle


                         -         -         -         -         +         -         -:770
query           VSAHMVMVKNAKWIADRTVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVG
00402091   1/1  ----------------------------------------------------------------------
00440131   1/1  ----------------------------------------------------------------------
00425611   1/1  ----------------------------------------------------------------------
00453821   1/1  ----------------------------------------------------------------------
00440581   1/1  ----------------------------------------------------------------------
00418521   1/1  ----------------------------------------------------------------------
00379891   1/1  ----------------------------------------------------------------------
00365041   1/1  ----------------------------------------------------------------------
00371831   1/1  ----------------------------------------------------------------------
00531291   1/1  ----------------------------------------------------------------------
00527721   1/1  ----------------------------------------------------------------------
00383601   1/1  geldp-----------------------------------------------------------------
00470961   1/1  lehwhsgtmtrnvpwlrelapepfveinpedAaklgikdgdlVrvss.rrG.svlararvtdrvrpllvd
00425601   1/1  rlhs..qtrnnpwlrelargepvveinpedAaalGIkdGDlVevfn.drG.svlarAkvtervrpgvvfm
00469421   1/1  qlhsgtrtrnlpllrelapepvveinpedaaklgikdgdlVrvts.rrG.svvaravvtdrvrpgvvflp
00453811   1/1  hlhsgtrtgnvpllrelapepfveinpedAaelgikdGdlVrvesrrg..svllrarvtdrvrpgvvflp
00496341   1/1  lehlhs.mtrnvpllrellkvlllllesapepfveinpedAaklgikdGdlVrves.rrG.svvarakvt
00531281   1/1  hlhtgsrtrnvpllrelapepafveinpedAaklgikdgdlVrves.rrG.svvvrakvtdrvrpgvvfl
00463621   1/1  hlhsgtrtgrlpwlrelapepfveinpedAaklGikdGdlVrvts.rrG.svvaravvtdrvrpgvvflp
00466251   1/1  hlhsgtrtgrlpllrelapepfveinpedAaklGikdGdlVrvts.rrG.svvaravvtdrvrpgvvflp
00478571   1/1  grllehwhs..mtrnvpwlrelapepfveinpedAaklGikdGdlVrvss.rrG.svlarAvvtdrvrpg
00496581   1/1  hlhsqlrnrrlvpllrklapeppveinpedAaalGikdGDlVrvfn.drG.svlarAkvtdrvrpGvvfl
00418511   1/1  hlhsgtrtrnvpllrelvpepfveihPedAaalgikdgdlVrvfsrrGsvllrakvrgtdrvrpgvvflp


                         -         -         *         -         -         -         -:840
query           GRTSKLISGEYQFLKEGINPQWFTTGKVEPVVGSAPTNSSVRVRRL------------------------
00402091   1/1  ----------------------------------------------------------------------
00440131   1/1  ----------------------------------------------------------------------
00425611   1/1  ----------------------------------------------------------------------
00453821   1/1  ----------------------------------------------------------------------
00440581   1/1  ----------------------------------------------------------------------
00418521   1/1  ----------------------------------------------------------------------
00379891   1/1  ----------------------------------------------------------------------
00365041   1/1  ----------------------------------------------------------------------
00371831   1/1  ----------------------------------------------------------------------
00531291   1/1  ----------------------------------------------------------------------
00527721   1/1  ----------------------------------------------------------------------
00383601   1/1  ----------------------------------------------------------------------
00470961   1/1  gktvgvvflpfhwgyll.........aldkggavnvLtsdaldpls------------------------
00425601   1/1  phgwgylplvpglel..aldrggnaNvLtsdvldpvsltpeykq--------------------------
00469421   1/1  hgwgl................gnvNvltsdatdplsgpafkgtlVr------------------------
00453811   1/1  fgwg................ggnaNvLtsdaldplsgtpefkttlV------------------------
00496341   1/1  drvrpgvvflphgwghl..lllpldaaallkggnvNaLtsdaltdp------------------------
00531281   1/1  pfgww................ggnvNvLtsdaldplsgqpeykgtl------------------------
00463621   1/1  hgwghdlpvlg.galglargg.nvNvLtsdvltdplsggpafkatl------------------------
00466251   1/1  hgwghdlalpg.galglvr.ggnvNvLtsdaltdplsggpafkgtl------------------------
00478571   1/1  vvflpfgwwvglplvpglgglgvrggaanl----------------------------------------
00496581   1/1  phgwwhdplgggallllllgglalvlggggnnlltddatdplsgg-------------------------
00418511   1/1  fgww................ggaanvLtldaldplsgtpefkttl-------------------------