[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64528.1


[Show Plain Result]

## Summary of Sequence Search
   1::106
   8::105  2.3e-25 41.2% 0046798 00467981 1/1   omal protein S10                        
   1::106


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
00467981   1/1  -------kiriklksydlklLesvvkfivraakrlglkvsgpiplPtkrlrvtvlrsPhvdk.ksreqfe


                         -         -         *         -         -         -         -:140
query           MRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLI----------------------------------
00467981   1/1  mrthkrlidildltsetvdlllklnlpegVdvevk-----------------------------------