[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64590.1


[Show Plain Result]

## Summary of Sequence Search
   1::213
   1::213  2.9e-54 39.1% 0042499 00424991 1/1   RibB                                    
   1::214    1e-48 37.8% 0037940 00379401 1/1   RibB                                    
   1::214  2.4e-48 36.9% 0039907 00399071 1/1   RibB                                    
   1::215  2.4e-45 38.7% 0044038 00440381 1/1   RibB                                    
   1::213


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGIEDAIAAFKAGRLVMIYDGDDREAEVDFVIRADAVTPTTIRWLRQNAGGLLCFVTTREVGEILGLEFL
00424991   1/1  lsieeaiealraGklvlvvddedrenegdlviaAelvtpelinflvrhasGliclalteeraeklgLplm
00379401   1/1  llellglllssieeaiealraGklvlvvddedrenegdlvlaaelvtpelinfmirhasGliclalteel
00399071   1/1  llsieeaiealraGklvlvvddedrenegdlvlaAelvtpelinfmarhasGliclalteelakrlgLpl
00440381   1/1  llllsieeaiealraGklvlvvddedrenegdlvlaaelvtpelinflvrlasGliclalteeraerlgL


                         -         -         *         -         -         -         -:140
query           SSYYKRRGFLATAPYGDEPAFMGYVNHVKTKTGIRDVDKALTIRELAKVVQLAQRDPEEAREAFKANFYM
00424991   1/1  vdlnteasellelleelleddleddlgtaftvsvdargvtTGisaadRaltiraladlve......eeel
00379401   1/1  aerlgLplmve.........dntsdlgtaftvsvdaaegvtTGisaadraltirala............d
00399071   1/1  mvdl.......ndssygtaftvsidaaelgvtTGisaadRaltiraladp............dakpedlv
00440381   1/1  plmve.........dnsddlgtaftvsvdaalgvtTGisaadRaltirlladp............nakpe


                         +         -         -         -         -         *         -:210
query           PGHVPILGGRLGERWGHTELSLILAKAAGVPPAVVIVEVLGDHTEAMPVEEAREYSKTLGVPLVTGTEIK
00424991   1/1  dalpedfvrPGHvfplrardggvleRaGhteaavdLarlagllpaavicellnddgsmarldellefake
00379401   1/1  pdakpedlvrPGHvfplrakeggvleRaGhtEaavdLarlaGlkpaavicellnddgtmarlpellefae
00399071   1/1  rPGHvfplrardggvleRaGhtEaavdLarlaglkpaaviceilnddeeaegealeedgtmarldellef
00440381   1/1  dlvrPGHvfplrardggvleRaGhteaavdLarlaglkpaavicellneddgtmarldellefaeehglk


                         -         -         -         +         -         -         -:280
query           SLI-------------------------------------------------------------------
00424991   1/1  hgl-------------------------------------------------------------------
00379401   1/1  ehgl------------------------------------------------------------------
00399071   1/1  aeeh------------------------------------------------------------------
00440381   1/1  litie-----------------------------------------------------------------