[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64645.1


[Show Plain Result]

## Summary of Sequence Search
   1::546
 262::351  4.2e-08 25.6% 0052804 00528041 1/1   C-terminal domain-like                  
 266::357  4.4e-07 27.2% 0050142 00501421 1/1   C-terminal domain-like                  
   1::546


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIWFVATVSAVLAAVTLSFKYRADIIAFVSLMALVLVGVYDLREALSYLISPAVIVLFGSMVISGVIAD
00528041   1/1  ----------------------------------------------------------------------
00501421   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SGLLDRVARYISVRVRHVATASLLLYFVAGVASGFVSDVAIVLAMAVLIGDVAKRLGASPAAYVIPLAFA
00528041   1/1  ----------------------------------------------------------------------
00501421   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AAIGGRLTMVGNAGNVILLDIYQTTTGEKLNILAFTAPALLALAISVPLLLLISFYAQRFVPQLSTAVKF
00528041   1/1  ----------------------------------------------------------------------
00501421   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LVVTTEVGETLDGKTRQEVEKAYRVKILTKDRILLKYSTVLVKIAVSDIPSFMTSKDLILRPLGNNKGEH
00528041   1/1  ---------------------------------------------------rllllpnvldvleldgdle
00501421   1/1  -------------------------------------------------------lpnvldlllldgdle


                         -         *         -         -         -         -         +:350
query           MEFLIVTQRSRLVGKTLALEPIHNVFPVSIIGIVPSGPVESLESYVFRPGDEILVLGDEKVIERIAAYYR
00528041   1/1  lvevvvpegsplvgktlreldlrerygvlvvairrggeliinplgdtvLqagDvLlvvGtpedlerllel
00501421   1/1  lvevvvpegsplvgktlaeldlrerygvtvvairRggeliisplgdtvLeagDiLlvvGtpedlerllel


                         -         -         -         -         *         -         -:420
query           LERSKTLVKAFNPRLAASGISGLFAAVVLSQFAPASLAFIIGTFIALLGGGKAVERLYQYVSWETLIYVG
00528041   1/1  l---------------------------------------------------------------------
00501421   1/1  lglllla---------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SFLAIGTAAARIDLLKPITPLLNSPEYLFVIGLFLTNTLGLIPSAVLIGPYLTTKEMLMTYVLATIPILL
00528041   1/1  ----------------------------------------------------------------------
00501421   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PPAHPAIYLIYREYGLSIKDFLKISIPATAIAILATGIAVYLYYNLPIQTPIFQLP--------------
00528041   1/1  ----------------------------------------------------------------------
00501421   1/1  ----------------------------------------------------------------------