[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64884.1


[Show Plain Result]

## Summary of Sequence Search
   1::222
   3::218  1.6e-12 23.9% 0047406 00474061 1/1   p containing nucleoside triphosphate hy 
   3::141  3.1e-12 26.2% 0046913 00469131 1/1   p containing nucleoside triphosphate hy 
   1::116  8.2e-10 31.0% 0037384 00373841 1/1   p containing nucleoside triphosphate hy 
   3::141  2.5e-09 23.5% 0046842 00468421 1/1   p containing nucleoside triphosphate hy 
   4::141  2.8e-09 29.7% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
   5::141  7.9e-09 25.8% 0036095 00360951 1/1   p containing nucleoside triphosphate hy 
   4::116  1.7e-08 26.6% 0037385 00373851 1/1   p containing nucleoside triphosphate hy 
   3::198  3.1e-05 22.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   5::168  0.00019 22.4% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   1::222


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIRTGTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTIEAYRDARVKN
00474061   1/1  --mmkviavtsgkGGvGKTtvaanlAaalaelGkrVlliDlDpqgpslslllglepeppgladlla....
00469131   1/1  --mmkviavtsgkgGvGKTtlaanlaaalaerGkrVllvdlDlpqpslslllglepeelgladlllglvd
00373841   1/1  MplggkpkviavtsgkGGvGKTTtaanlAaalaerGkkVllidaDpqaslsdllgleaedlpvpvrglld
00468421   1/1  --mmkviav.sgKGGvGKTTtaanlAaalaelGkkVllvDlDpqgpltdlllgleaeptlvdllageidl
00387941   1/1  ---mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllglegeplgladllagead
00360951   1/1  ----kviavtsgkGGvGKTTtaanLaaalarlGkkVllidlDpqgpltdlllgleaeevvptladvlgge
00373851   1/1  ---rellllllllllllkgkpkviavtsgkGGvGKTTtaanLaaalaerGkkVllvdaDpqaslsdllgl
00490731   1/1  --dvslsvkkgkvialvG.kgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaee.....
00513761   1/1  ----kiiaivG.kgGsGKTTllnklaglladggkvlvidlDparanlpeqlgidirdlid.........l


                         -         -         *         -         -         -         -:140
query           LFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLSRITPIETFGLDKADLIVLVV
00474061   1/1  geadlddailptvvegldllpaglplagvellgper.....lrelleel..rgdyDyviiDtppgl..gt
00469131   1/1  ledvllktsspgldllpaggplagle.....lllsealrelleel..rddyDyviiDtpp..glgdltll
00373841   1/1  llageidledailptlvegldllpaglllaglelllelgrgpggde------------------------
00468421   1/1  edliledvlltglegldllpaggllpglaellrgpdeaealkelleal..agdyDyvliDtppglhdlgl
00387941   1/1  ledailetp.egldllpaglllagl.ellrgerlrelleel......addyDvviiDtppglgdltllal
00360951   1/1  ldlddvivev.legldllpaggllaglelllrgvdeaaallelldal..eedyDyvliDtppglgdlgll
00373851   1/1  egerlpvtvidvlrgledledlive...pgldllpag.llaeleel------------------------
00490731   1/1  ...............lgldvllgarggdlsgglrqr....larallgdydvliiDtp..gtldvllelal
00513761   1/1  etvmelglgpngalvfaleellttldillealell..eedydyiliDtpGglelrallalllaiaralaa


                         +         -         -         -         -         *         -:210
query           EGCEDCTKPITIIKKFFDGKLIIALNKHERGIEYPGAVVKIPFSATLDYYNRRGQFYTKPVTKLAEYLLQ
00474061   1/1  ltllalaaadlvllvttpellslrdalrllelleklglpvlgvvlNrvdprrslsle......eelaeel
00469131   1/1  a---------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00468421   1/1  l---------------------------------------------------------------------
00387941   1/1  a---------------------------------------------------------------------
00360951   1/1  t---------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00490731   1/1  lellkellaelgadvvllvvdat.lgleaadrilvlleglgvpgvvlNkldlvaeg..------------
00513761   1/1  deillvddptsgldaetqleilelllel------------------------------------------


                         -         -         -         +         -         -         -:280
query           ELKRVTRSRWIE----------------------------------------------------------
00474061   1/1  glpvlgvi--------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00468421   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------