[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64909.1


[Show Plain Result]

## Summary of Sequence Search
   1::270
   2::262  2.1e-40 42.5% 0039893 00398931 1/1   /beta knot                              
  92::167  2.1e-11 28.2% 0039892 00398921 1/1   ic acid-binding proteins                
   1::270


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLEYLVTPPYLRK
00398931   1/1  -lsrktvsvaiPtsildnakslelktylagqiaRaaaiFgvdeiviyddd..ledeakllaslleyletP
00398921   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIYIGGGKYAKVPKPYPIGTRLL
00398931   1/1  qylrkllfpisnelkfagllppLdilphlvidlls..glrealv..........................
00398921   1/1  ---------------------PhhlrkdeklleyreGvvldrsgkgtlvdvGldklvliekklepgtrvt


                         +         -         -         -         -         *         -:210
query           VRIEGTTSRPDTYRAAVYRGAPPDYWGYKIDVRPLQNLSEGFDTVILTGKEGKSICEAKPKIGKKTLVVF
00398931   1/1  ...........................................dagvdvligtsedgeplssakdelatr
00398921   1/1  vkl.....lkllkgllvspaePglyWG-------------------------------------------


                         -         -         -         +         -         -         -:280
query           GGPRKGVDEIFREAGLEPPGELINFAPGQGVETIRTEEAVFIVLSILNYIAKCSYKREAL----------
00398931   1/1  lrkfrgvlvvfggplgglpevl.......fdlvvntvpgqgsrtlRtEeall------------------
00398921   1/1  ----------------------------------------------------------------------