[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64927.1


[Show Plain Result]

## Summary of Sequence Search
   1::999
  17::520    2e-83 33.5% 0051910 00519101 1/1   side hydrolase/deacetylase              
  18::473  3.2e-80 31.3% 0044323 00443231 1/1   side hydrolase/deacetylase              
 689::916  1.5e-72 47.1% 0049898 00498981 1/1   like                                    
  17::512  3.6e-38 27.5% 0047723 00477231 1/1   side hydrolase/deacetylase              
 130::376  0.00035 23.2% 0051516 00515161 1/1   side hydrolase/deacetylase              
 236::333  0.00052 21.3% 0048464 00484641 1/1   side hydrolase/deacetylase              
   1::999


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKWTFLLTLFVIFLAAEPINIIFIFHNHQPWYLDFSKNELALPWVRMHAVGNYLKVPLLINQSGVSVAFT
00519101   1/1  ----------------mplylalvlhaHlPyyrdpesglylelpwvflhaledyqplirvlerlpparlt
00443231   1/1  -----------------klylalvlhaHqPyvrspelgeleeewlelaitedYlpllsllerlkdegpdf
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  ----------------Mkklkvalvphshlpvgwlpt.......tfddgvrrgydrlldllekypgikat
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSGSLIEQLNWYSNGTYTDARFRISEKIARGEPLTIEEKYAMLAVPGGFFDINWQNILNKHPRYAVLLGV
00519101   1/1  lslspvlleqlndyalgehfdrallwryleayrl...ilrllsvlnlmsfnfdftfsi............
00443231   1/1  kltlsfsPvLleqLedyllqerydrvleallelaekell...............................
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  ffvsgsllewl...........................................................
00515161   1/1  -----------------------------------------------------------dlprllygygs
00484641   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RNDAFNKCPPGNMTCVVSRFSDQDFIDLATLFNLLWIDPYIARQNPEIWALRNKTNYTREDLKKVLQIHL
00519101   1/1  ...............................................................sgwlleq
00443231   1/1  ........................rfrndlldllalfllawfg.........................ql
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  ......................................................................
00515161   1/1  ..drpdllwPggarlavslvvdveegaellvllgdglsevflsdlpgalllgdlpdkvvaltfDdGprvg
00484641   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ELIKQVLPVYKKLAEQGRIELVPVPYSHPLMPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEQ
00519101   1/1  leelypdllealrelaesGqvEllggpyyHpilpllpdte..edvraqillgqelfeelFGvrpkgfwlP
00443231   1/1  lalleeilgdliplfrelaesgqvellttpythpilPllpd...pedvlaQirlgieyfrerfgvrPeGl
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  .eerypelveaikelveeGhlEiaghgysHpdlpll....spedirrqilkgie.leelfGvrprgfwlP
00515161   1/1  tprlldlLkk.....ygikaTfFvvgenaernpelvreivaaG.heignHtysHpdltkl....speeir
00484641   1/1  -------------------------ysHpnlttl.speelre...elerskealeeltGvkplrlfrpPy


                         -         *         -         -         -         -         +:350
query           AVNDEVLRLFANAGYIWTVTDEDVLKATAPGASHFKLYFVQYGDRKLYVFFRDKTLSDNIGFRYSSLSPE
00519101   1/1  EfayspellqilaeaGiryfvtdglslllangf.phyglyrpylldgglavffrdfelsdligfrfsgyp
00443231   1/1  WlPElAyspdgllklpaegdsfgytgglleilaeaGirytildghvlllsrplprygflwvglvgselll
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  dggyspelpdllaelGfkyfitdrldwndddkdpkalfrpwrgpdgseillvfprnlylsdligfrf...
00515161   1/1  eeiekaiealekitGkkpkgfrpPyg..spntldllaelGyflydwsvd.........sddwPylpwlnt
00484641   1/1  gsynprvlellkelGykyvlwsvdgddwlrlgllspeaildrvldaldpgaii-----------------


                         -         -         -         -         *         -         -:420
query           AALADFVNYLKRVPREKCSVVVIALDGENPWENYPNFGDDFLRVFFQGLAQLEKNGTVKIWKPSDFIKAC
00519101   1/1  gdplareflgdlgaildgesliligtddggggptmlkvvritldgenlwekypydpleflealye...ha
00443231   1/1  yrPyllegglavffrDlelsyqvwsselGyPgdllYrefhkdldliGfkysrvtgeeaglgekelydrel
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  .....aeefldylkdlfdkgrppvvligldgenfgehpptegmperlrflerlleyinghpd...vwfst
00515161   1/1  gaggileipltlilngsiillhdgfv--------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GNEAAELPQREFKYFDLHLDLSFYKSIRDLPTRLVNGRIAEGSWSGGGSLAVWIGDPDENVWWMWLKKAR
00519101   1/1  edfpgirlvtlselldrhgpeglvvlpfdsel.................................fghww
00443231   1/1  AfekvlehaedfldrllsildldpppvvvvalDgEl.fghwpeegptfLeall-----------------
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  pseyldale...............................ptgpvdpfpysw...gyleyWr.......l
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EEVGVNRTWDVIFPLLIAEASDWPFWYGGDMGSPITFDPIAKSALITYYKRAGLEPPRYLLSPAYPAGTP
00519101   1/1  regst..wLgnvlensawdalvkltt...l----------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  raannllyvellenlkeaelle------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           REDKVAGRGDGRIRTYQGLTVHVNTTHIWAEGAPCGVLYISNPDIPRSPYIFRGAVRGIYGESLNIIADM
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           AIDTCSGVVYLSDGGVFYPVGRAASLSFIGARPGGRLYLEFKGLVYIVNIPEAEVAQQLLLKAADPVGDD
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  ----------------------------------------------------------llleleDPlGDd
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           FGPGRYQYPKNPVFKPGVFDLTEFSLYDVGDKLRFVFKVRELGDNPWGGPAGFSLQFFHVYINRGSGSRN
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  nGpGtytyPtdpvfkpGvfDLtkvevlekgdnlvfvvtlaelltnPWngp.GFslqliniYldtgkg.ge
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           DTLGLRVALCRDAAWDVALLIGPGWSGGNRIVYSDNTYVDDAMSIKVAPNNTVVADVPKRYIGEFNSSWK
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  tllglgvnldpsapWdvallitgwg.vgalvvegdgtisdavlvlvvpsgntivakvpkkllglldpsly
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ITVFLTSWDGYGPDNIRNFGVVSDEWTAGGADPVAVLANVAPRVFDLLAETAEQQIKALTSYQVTRLPNG
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  gwylavlvgsydgygpdklrpvakealleagvneyegewefGggdplfdgsiasavlagvaPrvlDvLvp
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TYLGRPTRVCAYISGGKATETYTVTQTITITQTEVSTTTKTIATRETITSTYVTTATQVIKEADWTTASL
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  egetqe----------------------------------------------------------------
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           IGILALTIGLVAGLLTRRR---------------------------------------------------
00519101   1/1  ----------------------------------------------------------------------
00443231   1/1  ----------------------------------------------------------------------
00498981   1/1  ----------------------------------------------------------------------
00477231   1/1  ----------------------------------------------------------------------
00515161   1/1  ----------------------------------------------------------------------
00484641   1/1  ----------------------------------------------------------------------