[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64945.1


[Show Plain Result]

## Summary of Sequence Search
   1::181
   1::171  8.4e-38 33.9% 0035299 00352991 1/1   ate-ferredoxin oxidoreductase, PFOR, do 
   1::181


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATSLVIVGVGGQGVLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYAPIVEEGGADY
00352991   1/1  gtieilfwGvGgqGvvtagkilakaaglltglyvqayevygsekrGGvvvshlrfsdkpirspylidead


                         -         -         *         -         -         -         -:140
query           VIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGLKSYIVPCFDIAIELGSPLYE
00352991   1/1  lvvvldpslleaydvlaglkegGtlllntslvspeelekklpaeflkllaekniklyvidatkiAlelgl


                         +         -         -         -         -         *         -:210
query           NAVMLGFFSQLAGLPMPPSLDERNREAFRRGALVYNSLAPY-----------------------------
00352991   1/1  grriNtvmlgaffkllgilpleeaiealkes---------------------------------------