[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64946.1


[Show Plain Result]

## Summary of Sequence Search
   1::390
 143::347    2e-25 22.9% 0052450 00524501 1/1   in diphosphate-binding fold (THDP-bindi 
 135::347  1.5e-23 25.2% 0041167 00411671 1/1   in diphosphate-binding fold (THDP-bindi 
 141::304  1.6e-21 27.4% 0042102 00421021 1/1   in diphosphate-binding fold (THDP-bindi 
 144::305  1.6e-21 26.5% 0051271 00512711 1/1   in diphosphate-binding fold (THDP-bindi 
 134::303  5.4e-21 24.5% 0048897 00488971 1/1   in diphosphate-binding fold (THDP-bindi 
 138::319  2.9e-19 29.1% 0049968 00499681 1/1   in diphosphate-binding fold (THDP-bindi 
 137::329  4.5e-18 27.6% 0045858 00458581 1/1   in diphosphate-binding fold (THDP-bindi 
 142::310  2.1e-17 24.7% 0052104 00521041 1/1   in diphosphate-binding fold (THDP-bindi 
 309::389  1.2e-16 38.0% 0038470 00384701 1/1   S ferredoxins                           
 303::385  9.6e-16 38.3% 0052779 00527791 1/1   S ferredoxins                           
 143::304  8.6e-15 25.3% 0042411 00424111 1/1   in diphosphate-binding fold (THDP-bindi 
 321::379  1.5e-14 37.3% 0039666 00396661 1/1   S ferredoxins                           
 141::304  5.6e-14 21.7% 0042488 00424881 1/1   in diphosphate-binding fold (THDP-bindi 
 295::379  3.1e-13 29.8% 0047184 00471841 1/1   S ferredoxins                           
 142::304  3.4e-13 22.4% 0042045 00420451 1/1   in diphosphate-binding fold (THDP-bindi 
 143::304    5e-13 23.7% 0045130 00451301 1/1   in diphosphate-binding fold (THDP-bindi 
 322::385  5.7e-13 41.3% 0035446 00354461 1/1   S ferredoxins                           
 319::389  1.4e-12 32.4% 0039142 00391421 1/1   S ferredoxins                           
 320::392  1.4e-12 35.6% 0039453 00394531 1/1   S ferredoxins                           
 137::298  1.7e-12 29.1% 0044439 00444391 1/1   in diphosphate-binding fold (THDP-bindi 
 322::389  1.7e-12 37.3% 0047149 00471491 1/1   S ferredoxins                           
 309::378  2.5e-12 30.0% 0037513 00375131 1/1   S ferredoxins                           
 137::299    4e-12 28.9% 0049028 00490281 1/1   in diphosphate-binding fold (THDP-bindi 
 322::379  7.4e-12 41.4% 0042562 00425621 1/1   S ferredoxins                           
 322::388  8.2e-12 37.9% 0053368 00533681 1/1   S ferredoxins                           
 145::299  1.1e-11 24.3% 0042410 00424101 1/1   in diphosphate-binding fold (THDP-bindi 
 280::379  1.3e-11 28.4% 0045037 00450371 1/1   S ferredoxins                           
 320::377  1.7e-11 44.8% 0044815 00448151 1/1   S ferredoxins                           
 309::384  1.8e-11 31.1% 0045859 00458591 1/1   S ferredoxins                           
 317::381  1.8e-11 36.1% 0044015 00440151 1/1   S ferredoxins                           
 322::392  2.1e-11 35.7% 0049159 00491591 1/1   S ferredoxins                           
 322::377    6e-11 42.9% 0046874 00468741 1/1   S ferredoxins                           
 322::378  6.9e-11 41.8% 0036609 00366091 1/1   S ferredoxins                           
 319::379  8.9e-11 45.0% 0046879 00468791 1/1   S ferredoxins                           
 321::379  9.5e-11 42.4% 0043631 00436311 1/1   S ferredoxins                           
 320::385  1.3e-10 30.3% 0052774 00527741 1/1   S ferredoxins                           
 291::380  1.5e-10 30.2% 0040210 00402101 1/1   S ferredoxins                           
 322::377  1.7e-10 40.0% 0046749 00467491 1/1   S ferredoxins                           
 291::390    3e-10 20.6% 0052928 00529281 1/1   S ferredoxins                           
 322::377    3e-10 40.0% 0046170 00461701 1/1   S ferredoxins                           
 322::377  3.9e-10 40.0% 0052658 00526581 1/1   S ferredoxins                           
 324::378  5.1e-10 40.7% 0035614 00356141 1/1   S ferredoxins                           
 186::298  2.2e-09 33.0% 0041402 00414021 1/1   in diphosphate-binding fold (THDP-bindi 
 275::377  2.7e-09 25.8% 0052034 00520341 1/1   -helical ferredoxin                     
 319::379  5.7e-09 32.8% 0038361 00383611 1/1   S ferredoxins                           
 186::299  1.8e-08 24.3% 0042044 00420441 1/1   in diphosphate-binding fold (THDP-bindi 
 186::299  4.6e-08 27.8% 0039738 00397381 1/1   in diphosphate-binding fold (THDP-bindi 
 303::377  1.2e-07 32.4% 0047791 00477911 1/1   -helical ferredoxin                     
 283::377  2.2e-07 26.4% 0048346 00483461 1/1   -helical ferredoxin                     
 183::299  3.2e-07 26.8% 0044478 00444781 1/1   in diphosphate-binding fold (THDP-bindi 
 183::299  6.1e-07 27.3% 0042487 00424871 1/1   in diphosphate-binding fold (THDP-bindi 
 186::299    6e-06 27.7% 0036596 00365961 1/1   in diphosphate-binding fold (THDP-bindi 
 186::299  7.3e-06 31.4% 0050394 00503941 1/1   in diphosphate-binding fold (THDP-bindi 
   5::76   1.1e-05 31.0% 0042966 00429661 1/1   terminal domain-like                    
 316::373  1.2e-05 36.2% 0038466 00384661 1/1   -helical ferredoxin                     
 177::301  2.3e-05 26.7% 0048896 00488961 1/1   in diphosphate-binding fold (THDP-bindi 
 188::299  5.5e-05 26.4% 0042101 00421011 1/1   in diphosphate-binding fold (THDP-bindi 
   5::76     6e-05 31.0% 0039060 00390601 1/1   terminal domain-like                    
 186::299  0.00023 22.7% 0039197 00391971 1/1   in diphosphate-binding fold (THDP-bindi 
 190::301  0.00086 19.8% 0051270 00512701 1/1   in diphosphate-binding fold (THDP-bindi 
 143::299  0.00089 21.4% 0052449 00524491 1/1   in diphosphate-binding fold (THDP-bindi 
   1::390


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKWRELEKLSSDFLQIEGSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPKVREIARGGEV
00524501   1/1  ----------------------------------------------------------------------
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00499681   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00521041   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00471841   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00471491   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00425621   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00424101   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00448151   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00491591   1/1  ----------------------------------------------------------------------
00468741   1/1  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00468791   1/1  ----------------------------------------------------------------------
00436311   1/1  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00420441   1/1  ----------------------------------------------------------------------
00397381   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00444781   1/1  ----------------------------------------------------------------------
00424871   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00429661   1/1  ----dytlpigkaevlregk.dvtivayGtmvalaleAaeelgisaevidlrtlkPldeelilelvkktg
00384661   1/1  ----------------------------------------------------------------------
00488961   1/1  ----------------------------------------------------------------------
00421011   1/1  ----------------------------------------------------------------------
00390601   1/1  ----dytlpigkaevlregk.dvtivayGsmvalaleAaeelgisaevidlrtlkPldeelilelvkktg
00391971   1/1  ----------------------------------------------------------------------
00512701   1/1  ----------------------------------------------------------------------
00524491   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVVEEGDPVVEIQLRALGINTRGKIDGYFPKHGELDINKTALGLAKALGLSYAPPTPLKPPLEPPPRPPV
00524501   1/1  ----------------------------------------------------------------------
00411671   1/1  ----------------------------------------------------------------plrppl
00421021   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00488971   1/1  ---------------------------------------------------------------rpgllgh
00499681   1/1  -------------------------------------------------------------------ppr
00458581   1/1  ------------------------------------------------------------------vken
00521041   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00471841   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00444391   1/1  ------------------------------------------------------------------rlnv
00471491   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00490281   1/1  ------------------------------------------------------------------rlvl
00425621   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00424101   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00448151   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00491591   1/1  ----------------------------------------------------------------------
00468741   1/1  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00468791   1/1  ----------------------------------------------------------------------
00436311   1/1  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00420441   1/1  ----------------------------------------------------------------------
00397381   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00444781   1/1  ----------------------------------------------------------------------
00424871   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00429661   1/1  rvvvve----------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00488961   1/1  ----------------------------------------------------------------------
00421011   1/1  ----------------------------------------------------------------------
00390601   1/1  rlvvve----------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00512701   1/1  ----------------------------------------------------------------------
00524491   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LCPGCPHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQDLITHMGSSVGLGAGIALATGQFVVATVG
00524501   1/1  --ppltpqrvlralrealpe.daivvsdvGtsqlwaarylrlpkprrfltsgglgtmGyglpaAlGakla
00411671   1/1  ldpglgpqyvlkalsealpelpddaivvsdvGcsqfwaarylrlrrprsfltsgglgtmGyglpaAlGaa
00421021   1/1  lcpglgpqevlaalsealpe.daivvsdvGcsqlwaarylrlrgprtfltsgglgtmGyglpaAlGaala
00512711   1/1  ---eplgpaevlralaealpe.daivvsdvGcsqrwaaryltlrrprtfllsgglgtmGyglpaAlGaal
00488971   1/1  lglglgpeavlvalaaalpe.ddivvsdvgchqrwaarlltgrgprtllnsglgsmGyglpaAlGaalaa
00499681   1/1  lcpglgpaavlralskalpelglledaivvsdvgcsqrwaarylrfdkprtfltsgglgsmGyglpaAlG
00458581   1/1  lldlltvkgsqllqpllefsGacagcgetpylklltqlfgdrllianatGcssiyggslpttpytlnadg
00521041   1/1  -tdggplspghvlralyellllpedaivvsdvgcsqrwgarllgfpeprtflvsgglgimGyglpaAlGa
00384701   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00424111   1/1  --sdgpplgpqyvllalsealpedaivvsdvgtsqlwgarllrlrgprtfltsgglgtmGyglpaAlGaa
00396661   1/1  ----------------------------------------------------------------------
00424881   1/1  lggplgpaevlralaellp.ddaivvtdvGtsqfwaarlllpkprslltsgglgsmGyglpaAlGaalal
00471841   1/1  ----------------------------------------------------------------------
00420451   1/1  -dgdpltpayvlkalsellpddaivvtdvglsqfwa.rylrfpgprtfltsgglgtmGyglpaAlGaala
00451301   1/1  --splgpqevlralaellp.ddaivvtdvGssqfwarylrlprprrfltsgglgtmGyglpaAlGaalaa
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00444391   1/1  lalgvplleifaellgklpgh..pgggdvkmhlgseslgvlfntghlgtglpvAvGaAlAakllgkdrvv
00471491   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00490281   1/1  lghgspllyaflelrgkledl..sggrd.gsyhpghpelgvefttghlgtglpvAvGmalalkllgpdrv
00425621   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00424101   1/1  ----kpltvaealvealkelgvdivfgdpGtsilpladalraprpgirsiglghegyalpaAiGaalatg
00450371   1/1  ----------------------------------------------------------------------
00448151   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00491591   1/1  ----------------------------------------------------------------------
00468741   1/1  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00468791   1/1  ----------------------------------------------------------------------
00436311   1/1  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00414021   1/1  ---------------------------------------------hlgtglpvAvGaalAakllgkdrvv
00520341   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00420441   1/1  ---------------------------------------------hegyalpaAiGaalatgrgvvlvtg
00397381   1/1  ---------------------------------------------hegaalpaAlGaalatgkpgvvlvt
00477911   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00444781   1/1  ------------------------------------------ltrgegyalpaAlGaaratgkrgvvlvt
00424871   1/1  ------------------------------------------lsghegyalpaAiGaaratgrgvvlvtg
00365961   1/1  ---------------------------------------------plGtglpaAvGaAlAaklagpdrvv
00503941   1/1  ---------------------------------------------hlgtglpvAvGmAlAlkllgkdvvv
00429661   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00488961   1/1  ------------------------------------mtgaellveaLkelgvdtvfgvpGsrilplldal
00421011   1/1  -----------------------------------------------etllltgaealveaLkalgvdtv
00390601   1/1  ----------------------------------------------------------------------
00391971   1/1  ---------------------------------------------plGqglpaAvGaAlaakllgalfnr
00512701   1/1  -------------------------------------------------llllelmlkllltgaealvea
00524491   1/1  --mmlltgaealveaLlaagvdt.....vfgvpgtpnlplldalaellpgirfilvrhEgaAlpaAiGaa


                         -         -         -         +         -         -         -:280
query           DSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSV
00524501   1/1  npdrrvvaivGDGsfqm.glqelatavrynlpviivvlnNggygmirqqqeltggdrygtdlpnpdfakl
00411671   1/1  larpdrrvvaiiGDGsflmg.lqelatavrynlpviivvlnNggygmtrgqqsltygggasgtdlpnpdf
00421021   1/1  npdrrvvaiiGDGsflmg.lqelatavrynlpviivvlnNggygmtrgqqeltgggrygtdlpnpdfaal
00512711   1/1  alpdrrvvaviGDGsflmg.leelntaarynlpvlivvlnNggygitgglqslttgygysgttlptglll
00488971   1/1  pdrrvvaviGDGsflmg.leelntaarynlpvvivvlnNggygitrglqeltggeglsgtdlpnpdfakl
00499681   1/1  aalanpdrrvvaiiGDGsflmg.lqelataaryklpvlivvlnNggygitgqlqettaggrysttdllgn
00458581   1/1  rgPawanslfedaaefglghrlcpgcgrfailrlllkalrelgldlllaelpgklvgvstgi.cssrlpp
00521041   1/1  alapdrrvvaiiGDGsfqmglqe.lstaarlklpvlivvlnNggygitggqeraggrpsgtdlpppdfaa
00384701   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00424111   1/1  lanpdrrVvaivGDGsfqmg.lqelatavrynlpviivvlnNngygivrgqqeltygerlsgtdlpnpdf
00396661   1/1  ----------------------------------------------------------------------
00424881   1/1  kllgpdrrvvalvGDGsf.gmtlqelataaryglpviivvlnNggygiirqlqeltyggrdlpnpdfakl
00471841   1/1  ----------------------------------------------------------------------
00420451   1/1  npdrrvvaivGDGsf.gmtlqelataaryglpviivvlnNggygitrqqqsltypgndlpnpdfaklaea
00451301   1/1  pdrrvvaivGDGsfqmg.lqelataaryklpviivvlnNngygiirglqelfyndlpnpdfaklaeafGa
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00444391   1/1  valiGDGal.seGvvhealnlaallglpvlfvvvNNqigistpvgrqrs.tpdladraeafgipgirVdG
00471491   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00490281   1/1  vvaviGDGalseGvvhEAlnlagllklpvlivvvdNgi.gistpvdlrssayedlaarfeayGipvirvd
00425621   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00424101   1/1  drgvvlltgdggflnl.lqelatavryglpvvvivgnnggygigrgaqq...evdfaklaeafgkkgvrv
00450371   1/1  ---------------------------------------------------------------------l
00448151   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00491591   1/1  ----------------------------------------------------------------------
00468741   1/1  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00468791   1/1  ----------------------------------------------------------------------
00436311   1/1  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00414021   1/1  valiGDGal.seGvvhEalnlaalyklpvlfvvvnNqigistpve..rssayptl.laeafgipgirVdG
00520341   1/1  ----------------------------------------------------------------dlspfl
00383611   1/1  ----------------------------------------------------------------------
00420441   1/1  dggflnl.lqelatavryglpvlvivgnnggygigrgaqqelyggdlpnpdfvklaeafgkkgvrvt..t
00397381   1/1  gdggfl.nllqelatavryglPvvvivgnnggygigrgaqqel...dfvklaeafgkkgvrvt..speel
00477911   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00444781   1/1  gdggflnl.lqelatavreglPvlvivgnnpgygivgrgaqqe..pdfvklaeaygkygvrvt..dpeel
00424871   1/1  dggflnl.lqelatavreglpvvvivgnnggygigrgaqqe...pdfvklaeafgkkgarvt..dpeelp
00365961   1/1  valiGDGal.seGmvhEalnlagllklpvlfvvenNgy.aistptglatasedlaaraeayGipgirVdG
00503941   1/1  valiGDGalseGvvhEAlnlAgllkl........pvlfvvedNgi.gistpvgrsrssedladraeafgi
00429661   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00488961   1/1  adgirlilvrhEggAapaAdGyaratgkpgvvlvtggpGflnl.ltelatavrdglPvlvivgnngtlgl
00421011   1/1  fgvpGssnlplldaladsgirvilvrhEgaaapaAiGaaratgkpgvvlvtggpgflnl.lqelatavre
00390601   1/1  ----------------------------------------------------------------------
00391971   1/1  plldlpdrvvvaliGDGalneGvslealnlAghlkldnlivivdnNgysidgpvglql..ledlakrfea
00512701   1/1  LlaagvdhvfgvpGtpnlplldalakspgirfilvrhEqaAafaAiGaaratgkpgvvlvtsgpGalnl.
00524491   1/1  ratgkpgvvlvtggpGflnl.ltelatavrdglPvvvivgnnggygigrgaqqev...dfvalaeaygky


                         -         *         -         -         -         -         +:350
query           EIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDR
00524501   1/1  aeafGakgvrve..dpeeleaalkealaaakgdgpvlievlvdpeenvpplvplgkvlvallsllel---
00411671   1/1  aklaeafGakgvrv..edpeeleealkeala...adgpvlievltdpgegvlp.....lvplgkale---
00421021   1/1  aeafGakgvrvd..dpeeleealk----------------------------------------------
00512711   1/1  lgllpdfaklaeafGapgvrvdgpd---------------------------------------------
00488971   1/1  aeafGakgvrvdgpd..eleeal-----------------------------------------------
00499681   1/1  pdfaklaeafGakgvrvd..dpeeleealkeal...asd-------------------------------
00458581   1/1  yl....nsllgtlhgralgvalglklagpdlvvvvigGDGdaydiGfea---------------------
00521041   1/1  laeafGapgvrvdgpd.....eleealeea----------------------------------------
00384701   1/1  ----------------------------gllgllgdlslgvvvidedkCigCglCvra..CPvgaislve
00527791   1/1  ----------------------cPlgalvlldngrgdislpivvidedkCigCgaCvaa..CPtgaitgd
00424111   1/1  aklaeafGakgvrvd..dpeelee----------------------------------------------
00396661   1/1  ----------------------------------------vavidedkCigCghcedaaCvevCPvgait
00424881   1/1  aeafGakgvltvrvedveeleaal----------------------------------------------
00471841   1/1  --------------lllllllalcplvcplgalp.llslglvvidedkCigCglCvaaCpvgaivlelek
00420451   1/1  fGakyvalgirvetpd.....ele----------------------------------------------
00451301   1/1  nyvaridghkgvrvdtpdel..ee----------------------------------------------
00354461   1/1  -----------------------------------------avvdldkCigCglapCvavCpvgaill.e
00391421   1/1  --------------------------------------rmrvvvdedkCigCgaCvaaCpvgaivlddgl
00394531   1/1  ---------------------------------------llvvidldkCigCglCvraCpvgaivlvell
00444391   1/1  nDveavyaalkeaverar----------------------------------------------------
00471491   1/1  -----------------------------------------ividldkCigCedglCvevCpvgaivl.e
00375131   1/1  ----------------------------lgaklkldlllglvvidedkCigCgrCvraCpvgaitlvlll
00490281   1/1  GhDpeavyaalkeAleyar---------------------------------------------------
00425621   1/1  -----------------------------------------MkvkaqygmvidldkCigCgaCvvaCkee
00533681   1/1  -----------------------------------------ivvdpdkCigCglapCvevCpvgaiyl.e
00424101   1/1  t..dpeelpealkealala---------------------------------------------------
00450371   1/1  lllllalllllcgccgdcvcayacptgail.....grergivvidedkCigCglCvaaCPvgaisldglg
00448151   1/1  ---------------------------------------lkvvvdedkCigcglCvlvCpvgaillddgl
00458591   1/1  ----------------------------llplekldilrpvividldkCigCgaCvav..Cpvgaitlvl
00440151   1/1  ------------------------------------marygividlskCigcgaCevaCkdenllpvglt
00491591   1/1  -----------------------------------------vlidldkCigCgaCvlaCpvgaillgde.
00468741   1/1  -----------------------------------------vvvdedkCigcglCvlvCpvgaillddgl
00366091   1/1  -----------------------------------------llvdlelCigcglCvevCpvgaill..dg
00468791   1/1  --------------------------------------lglvvvdedkCigcglCvlacp.daivldddg
00436311   1/1  ----------------------------------------lglvvvdedkCigcglCvlacPvgailldd
00527741   1/1  ---------------------------------------glivideekCigCgrCvraCpevaitlvlgl
00402101   1/1  ----------hlclegicggcgfcilacptgalddggsvkil.idlskCigCgaCvaaCptelllpflpg
00467491   1/1  -----------------------------------------llidldlCigcglCvkvCpvgaill.ldg
00529281   1/1  ----------fvillsvcigctacevacpvgai...lkdglividaelcigcgpCvrvCPagaieivedg
00461701   1/1  -----------------------------------------llidldlCigcglCvkvCpvgaill.ldg
00526581   1/1  -----------------------------------------llidldlCigcglCvkvCpvgaill.ldg
00356141   1/1  -------------------------------------------llidldkCigCgaCvlaCpvgaillve
00414021   1/1  ndveavyaalkealeyar----------------------------------------------------
00520341   1/1  dkllaicpglg..........pctgvcpelaeilvdperpkilidldkCigCgaCvaaCPtgaitgdflg
00383611   1/1  --------------------------------------qkgilidldkCigCgaCvvaCkeenilpalll
00420441   1/1  peelpealdealaaalrpg---------------------------------------------------
00397381   1/1  pealdeAlalalsgrpgpv---------------------------------------------------
00477911   1/1  ----------------------lcifcglcvlacpllaldvtvtypleallsperfrpl.idldkCigCg
00483461   1/1  --lsvffdllksikpllapdvtlapp...kellqspedrrkl.idldkCigCgaCvaaCPvyaitgdefl
00444781   1/1  pealaralaaalsgrpgpv---------------------------------------------------
00424871   1/1  ealdralaaal.grpgpvl---------------------------------------------------
00365961   1/1  ndvealyaalkealerars---------------------------------------------------
00503941   1/1  pvirVdGhdveavyaalke---------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00384661   1/1  -----------------------------------laaglgavididkclgcgacvvacpvelnlpvgkl
00488961   1/1  grgaqqel..pdfvklaeayg-------------------------------------------------
00421011   1/1  glPvvvivgnngglglgrg---------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00391971   1/1  yGwnvirvdGhsldveavy---------------------------------------------------
00512701   1/1  ltglatavrdglPvvvivgqr-------------------------------------------------
00524491   1/1  alrvt..speelpealarA---------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KAHVDPALCVGCGICAEVCPFNAFKPEGKREAWLELWRQA------------------------------
00524501   1/1  ----------------------------------------------------------------------
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00499681   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00521041   1/1  ----------------------------------------------------------------------
00384701   1/1  ldpegkvvidpdkCtgCglCvevCPvegAitlvpleeel-------------------------------
00527791   1/1  ealdprgriieldgkvplrfridpdkCigCgaCve-----------------------------------
00424111   1/1  ----------------------------------------------------------------------
00396661   1/1  ldedgllivvidpdkCigCglCvevCPtg-----------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00471841   1/1  glvvidlekCigCgaCvevCptgaitlvd-----------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00354461   1/1  dgivvidpdlCigcglCvevCPvgaillellllll-----------------------------------
00391421   1/1  cvrvcptgdgivvidpdlcigcgaCvaaCPvgaitleee-------------------------------
00394531   1/1  glllllllvvidpdlCigCgaCvevCPtgaitlvdllelell----------------------------
00444391   1/1  ----------------------------------------------------------------------
00471491   1/1  dglvvidpdlCigCglCvlvCPvgaillkllllllllll-------------------------------
00375131   1/1  llrgllllvglklvvvidlekCigCgaC------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00425621   1/1  nnlpvgveylwfnnvetkPglgyprgaed-----------------------------------------
00533681   1/1  dgivvidpdkCigCglCvavCPvgaitlepelglaekc--------------------------------
00424101   1/1  ----------------------------------------------------------------------
00450371   1/1  lerlvlllklvidlekCigCgaCvevCPv-----------------------------------------
00448151   1/1  lllvvdldlcigcglCvevCPvgAisl-------------------------------------------
00458591   1/1  lgpracilcpacvkvcptgallklegggrvvidl------------------------------------
00440151   1/1  lalldellrpllpvkflekgvvppllalylp---------------------------------------
00491591   1/1  llvidpdkCigCgdrglepaCvevCPvgaillgdllelllel----------------------------
00468741   1/1  lvvlvidldlcigcglCvevCPvgAis-------------------------------------------
00366091   1/1  lvlidldlcigcglCvlvCPvgailled------------------------------------------
00468791   1/1  lvvvllevdldlcigcgaCvevCPvgAis-----------------------------------------
00436311   1/1  ggvavkltlvvdedlcigcgaCvevCPvg-----------------------------------------
00527741   1/1  agrgldtrigtvidaskCvlCgaCvevCPtgAltl-----------------------------------
00402101   1/1  klrgkilltlaglgaaigrvdlsdigtypk----------------------------------------
00467491   1/1  lvvidldlCigcglCvlvCPvgaille-------------------------------------------
00529281   1/1  gglllrvvinaenCigCgtCviaCPtgaislvppeggvgp------------------------------
00461701   1/1  lvvidldlCigcglCvlvCPvgaille-------------------------------------------
00526581   1/1  lvvidldlCigcglCvlvCPvgaille-------------------------------------------
00356141   1/1  e.llvidpdlCigclgkgeegaCvevCP------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00520341   1/1  prcllcaacllacprgaitleerledg-------------------------------------------
00383611   1/1  arrvlellpaallplaallvlllelgvvg-----------------------------------------
00420441   1/1  ----------------------------------------------------------------------
00397381   1/1  ----------------------------------------------------------------------
00477911   1/1  aCvaaCPtgaitpdflgprglicalcl-------------------------------------------
00483461   1/1  gprglicalrlladprdaltkerledl-------------------------------------------
00444781   1/1  ----------------------------------------------------------------------
00424871   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00384661   1/1  lgrlyvprievpeldpeerlkdf-----------------------------------------------
00488961   1/1  ----------------------------------------------------------------------
00421011   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00512701   1/1  ----------------------------------------------------------------------
00524491   1/1  ----------------------------------------------------------------------