[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64972.1


[Show Plain Result]

## Summary of Sequence Search
   1::251
   2::157  3.2e-27 35.7% 0038061 00380611 1/1   vase-like                               
   2::157  3.9e-26 35.0% 0052924 00529241 1/1   vase-like                               
   1::251


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITAVTYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMASEVDKLEPRP
00380611   1/1  -mrvigYaRvStddqslerQlealeay....glevvkiyvd.gvSGtkl..dRpglqrlledlreg....
00529241   1/1  -mrvagYaRvStddqslerQlealkey....glevvkiyvD.gvsgtnl..dRpglqrlledlrag....


                         -         -         *         -         -         -         -:140
query           RVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVYRQFLRAVLAFVATMEREFIR
00380611   1/1  dvlvvtkldRLgrslldllellelllek.gvrlvsldegi....dtstpigrllldilaalaeferelis
00529241   1/1  dvlvvtkldRlgRnlldllelle.llkekgvrlvsldeg....idtstpagellltilaalaeferelis


                         +         -         -         -         -         *         -:210
query           QRTKTALERARLQGKVWNVAEKRRDLTQAVVEMYLSGASLRETARAFGLSLYEVRRILSNAGVYRPSPYT
00380611   1/1  ertraglaaakaeGkyl-----------------------------------------------------
00529241   1/1  ertkaglaaakakGkyl-----------------------------------------------------


                         -         -         -         +         -         -         -:280
query           CPRCFSKMKVAERTAKISNGKYTVVERLYCYNCGYEEIREG-----------------------------
00380611   1/1  ----------------------------------------------------------------------
00529241   1/1  ----------------------------------------------------------------------