[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL65054.1


[Show Plain Result]

## Summary of Sequence Search
   1::346
 159::330  2.4e-37 35.9% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
 167::330  4.9e-33 33.5% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
 169::330  5.4e-32 34.4% 0050741 00507411 1/1   p containing nucleoside triphosphate hy 
  47::328  1.1e-30 25.6% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
 161::335  6.8e-29 31.0% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
 162::335    4e-28 30.0% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
 168::345  1.5e-26 33.3% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
 170::333  1.8e-26 31.9% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
 136::337  3.5e-26 30.5% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
 168::327  1.5e-25 27.8% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 147::330    4e-25 30.5% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
 166::330    5e-25 32.2% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
 148::331  1.7e-24 33.3% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
 137::328  9.1e-24 27.9% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
 169::328  1.3e-23 32.5% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
 166::336  2.3e-23 28.1% 0049269 00492691 1/1   p containing nucleoside triphosphate hy 
 168::333    5e-23 33.6% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
 164::334  6.2e-23 35.1% 0051472 00514721 1/1   p containing nucleoside triphosphate hy 
 165::339  6.5e-23 30.8% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
 168::337  8.7e-23 32.1% 0052914 00529141 1/1   p containing nucleoside triphosphate hy 
 165::339  9.7e-23 32.9% 0050482 00504821 1/1   p containing nucleoside triphosphate hy 
 168::327    1e-22 33.3% 0051458 00514581 1/1   p containing nucleoside triphosphate hy 
 166::331  1.8e-22 30.6% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 165::335  1.9e-22 31.2% 0048154 00481541 1/1   p containing nucleoside triphosphate hy 
 169::338  1.9e-22 29.7% 0048180 00481801 1/1   p containing nucleoside triphosphate hy 
 154::329  2.1e-22 34.9% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
 165::332  2.1e-22 34.6% 0051104 00511041 1/1   p containing nucleoside triphosphate hy 
 165::338  2.4e-22 28.0% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
 155::332  2.9e-22 31.7% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
 169::331  3.4e-22 32.9% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
 166::333  3.8e-22 34.6% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
 170::333  4.6e-22 33.6% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
 166::340  7.7e-22 32.5% 0051704 00517041 1/1   p containing nucleoside triphosphate hy 
 162::331  7.8e-22 34.4% 0052724 00527241 1/1   p containing nucleoside triphosphate hy 
 167::336  9.4e-22 32.1% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
 159::328  1.2e-21 31.8% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
 165::338  1.2e-21 33.1% 0052879 00528791 1/1   p containing nucleoside triphosphate hy 
 166::333  1.6e-21 27.8% 0039999 00399991 1/1   p containing nucleoside triphosphate hy 
 166::334  1.8e-21 32.0% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
 168::329  2.2e-21 33.8% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
 166::335  2.9e-21 28.2% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
 165::337  3.3e-21 33.1% 0050775 00507751 1/1   p containing nucleoside triphosphate hy 
 167::335  3.4e-21 32.2% 0046392 00463921 1/1   p containing nucleoside triphosphate hy 
 142::328  3.9e-21 22.3% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 166::329  5.8e-21 30.3% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
 169::333  6.7e-21 31.8% 0051450 00514501 1/1   p containing nucleoside triphosphate hy 
 153::330  9.1e-21 29.3% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
 167::347  1.9e-20 24.0% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
 167::332  2.4e-20 34.6% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
 167::333  3.2e-20 27.8% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
 166::333  3.3e-20 29.1% 0036153 00361531 1/1   p containing nucleoside triphosphate hy 
 165::340  3.6e-20 28.5% 0052625 00526251 1/1   p containing nucleoside triphosphate hy 
 163::332  5.6e-20 30.2% 0052841 00528411 1/1   p containing nucleoside triphosphate hy 
 169::333  5.8e-20 25.5% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
 167::330  6.5e-20 27.6% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
 164::336  7.9e-20 27.5% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
 169::345  8.2e-20 32.5% 0052785 00527851 1/1   p containing nucleoside triphosphate hy 
 163::333  8.8e-20 25.6% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
 111::300    9e-20 27.8% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
 164::330  9.1e-20 23.7% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
 166::343    1e-19 27.6% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
 165::335  1.1e-19 33.1% 0052502 00525021 1/1   p containing nucleoside triphosphate hy 
 165::334  3.1e-19 26.6% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
 165::331  3.9e-19 25.0% 0051461 00514611 1/1   p containing nucleoside triphosphate hy 
 145::333  5.7e-19 25.0% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
 111::303  6.8e-19 25.5% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
 145::330  7.1e-19 25.9% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
 164::331  1.1e-18 24.8% 0052528 00525281 1/1   p containing nucleoside triphosphate hy 
 167::331  1.3e-18 28.1% 0052501 00525011 1/1   p containing nucleoside triphosphate hy 
 169::330  1.5e-18 28.7% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
 156::330  1.6e-18 27.6% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
 164::330  1.6e-18 27.5% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
 164::333  1.6e-18 26.4% 0045559 00455591 1/1   p containing nucleoside triphosphate hy 
 165::330    2e-18 26.5% 0052735 00527351 1/1   p containing nucleoside triphosphate hy 
 161::334  2.1e-18 25.9% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 166::331  2.5e-18 23.8% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
 153::331  2.8e-18 27.3% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
 166::333  4.1e-18 29.9% 0037045 00370451 1/1   p containing nucleoside triphosphate hy 
 152::330  5.1e-18 26.5% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 162::340  5.3e-18 28.4% 0052005 00520051 1/1   p containing nucleoside triphosphate hy 
 166::343  5.5e-18 21.8% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
 166::331  6.5e-18 23.9% 0052680 00526801 1/1   p containing nucleoside triphosphate hy 
 169::334  6.7e-18 28.8% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
 163::330  7.2e-18 24.8% 0044416 00444161 1/1   p containing nucleoside triphosphate hy 
 165::330    8e-18 28.1% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
 160::338  9.7e-18 25.3% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
 166::331  1.2e-17 28.6% 0035814 00358141 1/1   p containing nucleoside triphosphate hy 
 167::331  3.8e-17 23.7% 0051562 00515621 1/1   p containing nucleoside triphosphate hy 
 164::338  5.7e-17 25.0% 0052002 00520021 1/1   p containing nucleoside triphosphate hy 
 166::335  5.9e-17 27.3% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
 164::330  6.8e-17 27.7% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
 167::331  9.5e-17 25.3% 0051471 00514711 1/1   p containing nucleoside triphosphate hy 
 166::330  9.8e-17 24.2% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
 166::333  1.1e-16 24.8% 0051459 00514591 1/1   p containing nucleoside triphosphate hy 
 167::329  1.1e-16 23.3% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 166::330  1.4e-16 24.7% 0038731 00387311 1/1   p containing nucleoside triphosphate hy 
 151::345  2.6e-16 26.8% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 167::331  2.6e-16 22.7% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
 164::333  2.8e-16 25.2% 0051460 00514601 1/1   p containing nucleoside triphosphate hy 
 167::331  2.8e-16 22.7% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
 164::331  4.1e-16 23.6% 0052615 00526151 1/1   p containing nucleoside triphosphate hy 
 163::333  8.7e-16 22.8% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
 156::331    1e-15 22.2% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
 164::330  1.1e-15 26.6% 0035281 00352811 1/1   p containing nucleoside triphosphate hy 
 162::338  1.6e-15 25.9% 0050792 00507921 1/1   p containing nucleoside triphosphate hy 
 165::331  2.2e-15 26.0% 0051462 00514621 1/1   p containing nucleoside triphosphate hy 
 165::330  2.5e-15 25.2% 0041234 00412341 1/1   p containing nucleoside triphosphate hy 
 168::330    3e-15 23.0% 0036279 00362791 1/1   p containing nucleoside triphosphate hy 
 157::331  6.2e-15 24.8% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
 167::331  7.4e-15 23.7% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 163::331  3.9e-13 25.9% 0052764 00527641 1/1   p containing nucleoside triphosphate hy 
 161::330  2.5e-11 26.1% 0051648 00516481 1/1   p containing nucleoside triphosphate hy 
 170::322  2.5e-10 22.6% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 152::327  4.4e-10 23.9% 0041170 00411701 1/1   p containing nucleoside triphosphate hy 
 165::331  4.3e-09 24.8% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
 118::291  1.2e-08 20.8% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 166::333  3.6e-07 21.7% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 157::330  5.1e-07 19.9% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
 158::305    1e-06 22.7% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 121::346  6.2e-05 20.9% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
 151::296  9.6e-05 21.8% 0037385 00373851 1/1   p containing nucleoside triphosphate hy 
 167::309  0.00016 23.3% 0050449 00504491 1/1   p containing nucleoside triphosphate hy 
   1::346


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEVVDKSKLPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIASILREMALRMP
00414001   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------hskkaldelelvldnadvilevvd
00409841   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTAPDKKALLDARRMYKARIIDL
00414001   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00424711   1/1  ardpllsldvrlaelle....gkprllvlnKaDlldaealalllealslglgnvafksalgglg......
00409841   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00471271   1/1  -----------------------------------------------------------------prail
00405881   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00517841   1/1  ------------------------------------------------------------------hgeg
00511561   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------reelrlvaanvdvvllvvdardplfslnll
00357861   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------nellrpivanvdlvlivvdardplfslnll
00356411   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00394721   1/1  -----------------------------------------------lvslleslelplleklrpvlldd
00414121   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00402371   1/1  --------------------------------------------------vlektgipltkllrpvlldd
00373851   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHI
00414001   1/1  ------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypftTldpnlgv
00475471   1/1  --------------------------mglkvalvGlPNVGKSTLlNaLtgakaivanypgtTrdpnlgvv
00507411   1/1  ----------------------------lkvalvGlPNvGKSTLfnaltgakaivanypftTrdpnlgvv
00424711   1/1  lealldlllellkellellrlslllkkglkvalvGlpnvGKSTLlnaLlgakvaivsdipgtTrdivlgv
00409841   1/1  --------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv
00432181   1/1  ---------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgv
00498681   1/1  ---------------------------llkvalvGlpnvGKStllnallgdkfivsnipgitidpnvgtv
00523461   1/1  -----------------------------akvalvGlpnvGKStLlnallgdkaivsdipgitrdiqtgt
00471271   1/1  elesliksllekllellkrlslklk...kglkvalvGrpgvGKStLlnallggdfaevgptpgtTrdikv
00405881   1/1  ---------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvv
00494851   1/1  ------ldllglelllslldrllllkkkllkvalvGlpgvGKStLlnallgakflakvsptpgttidikl
00484261   1/1  -------------------------kkllkialvGhpnvGKStLlnrltgekv.....pgttgaidii.g
00467111   1/1  -------lgepiqlidedgglldlldelleilseidqpvlvvaivGrpnvGKStLlNaLlgekvgfaivs
00517841   1/1  irdlldlidelrdlle......rldldlpkiavvGrpnvGKSsLlnallgrdflpvssgpgTtrptelrl
00511561   1/1  ----------------------------lkvalvGlpnvGKStllnallgadfaiventpgttidiklvv
00492691   1/1  -------------------------GlkkllkvvlvGdpnvGKStLlnrllggk.fvsdypgttrdfnvk
00518321   1/1  ---------------------------msslelkkllkvvlvGdpnvGKstLlnrllggkf.vsdypgtt
00514721   1/1  -----------------------lskkelkvvlvGdpnvGKssLlnrllggk.fvsdypgttgdnilktv
00465511   1/1  ------------------------ekkrllkvalvGlpnvGKStllnallgakfaivedepgitidinlg
00529141   1/1  ---------------------------llkvalvGrpnvGKstLl.rllggk.fvedypgtigdfivgtv
00504821   1/1  ------------------------eklrllkvalvGlpnvGKStllnallgakfaivedepgitidinlg
00514581   1/1  ---------------------------kelkvvlvGrpnvGKssLlnrllggkfivsyiptitrdfilkt
00470231   1/1  -------------------------elaellsllierlllrdlllelkllkvllvGdpnvGKStLlnrl.
00481541   1/1  ------------------------glkkllkvvlvGdpnvGKstLlnrllg.gvfvsdypgttgdfivkt
00481801   1/1  ----------------------------akialvGlpnvGKStllnallgadfaivedtpgttidinlgv
00488191   1/1  -------------fllsllrrlslllkrllkvalvGlpgvGKStLlnallgakflakvsptpgttrdik.
00511041   1/1  ------------------------ekkllkvvlvGrpnvGKstLlnrllggkf.vedypgttgdfllktv
00442331   1/1  ------------------------kkkllkivlvGdpgvGKstLlnrllgde.fvedyagttgdnivktv
00515821   1/1  --------------glllllllslelkkllkvalvGlpnvGKstLlnrllgakf.vsrgp..Tiginlgt
00520981   1/1  ----------------------------glkvvlvGdpnvGKstLlnrllg.gvfvsdypgttgdfivkt
00531961   1/1  -------------------------kkllkvvlvGdpnvGKstLlnrllggkf.vsdypgttgdfivktv
00526911   1/1  -----------------------------rkvalvGlpnvGKStLlnrllgak..vse.pgtTiginfgt
00517041   1/1  -------------------------kkllkvvlvGdpnvGKstLlnrllgdkfivsyiptitrdfllktv
00527241   1/1  ---------------------ms.elkllkvvlvGrpnvGKstLlnrllggk.fvedypgttgdfllktv
00528321   1/1  --------------------------dkllkvvlvGdpnvGKssLlnrllggkfivsyiptiltldfivk
00514481   1/1  ------------------alllslllkkllkvalvGlpnvGKstllnrllggkf..sey.gtTidinfgt
00528791   1/1  ------------------------kkkllkvvlvGdpnvGKstLlnrllggkf.vsdypgttrdfnlktv
00399991   1/1  -------------------------kkelkvvlvGdpgvGKstLlnrllgge.fvedypgttgdflvktv
00517931   1/1  -------------------------kkllkvalvGlpnvGKstllnrllgdkv..sdepgtTidinfgtv
00528591   1/1  ---------------------------sallllllelkkllkvalvGlpnvGKstLlnrllggkf..sey
00519271   1/1  -------------------------sllsslllkkllkvalvGlpnvGKstllnrllggkf..sey.gtT
00507751   1/1  ------------------------dlkllkvvlvGdpnvGKssLlnrllg.gkfvsdyppttgdfivktv
00463921   1/1  --------------------------lkllkvvlvGdpnvGKssLlnrllggk.fvsdypgttrdfivkt
00477011   1/1  -eelrklldlidklrdlllsld...lglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrl
00515101   1/1  -------------------------pleelllslllkkllkvalvGlpnvGKstllnrllggkf.verep
00514501   1/1  ----------------------------lkvvlvGrpnvGKstLlnrllggkfivsyiptitldfllktv
00378621   1/1  ------------glklllrrlslllkkglkvllvGlpgvGKstllnrlageef...dtpgttiginfgtv
00447401   1/1  --------------------------kelkivlvGdsgvGKttLlnrllgnkfivsyiptitvdiltkev
00518311   1/1  --------------------------gelkvvlvGdpnvGKssLlnrllggkf.vedypgttgdtilktv
00402391   1/1  --------------------------kelkvlllGlpnvGKstllnrllggdf...depgtTigvnvgtv
00361531   1/1  -------------------------kkllkivlvGdpgvGKstllnrllgne.fvedypgttgdlivktv
00526251   1/1  ------------------------kdkllkvvlvGdpgvGKstLlnrllggefiveyiptitvdflvktv
00528411   1/1  ----------------------sllkkllkvvlvGrpnvGKstLlnrllggkfaivsyiptitldfllgt
00513761   1/1  ----------------------------kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanl
00519521   1/1  --------------------------kelkilllGlpnvGKstllnrllgeef...dkpgpTrgvnvgtv
00504231   1/1  -----------------------mkkklrnvaivGhvnvGKsTLlnrLlgelglidkdvaiverergiTi
00527851   1/1  ----------------------------lelkvvlvGdpnvGKstLlnrllg.gkfvsdypgttgdnilk
00449901   1/1  ----------------------kkkkkllkillvGdsgvGKStLlnrllggkfivsyiptitvdiltktv
00497591   1/1  lrylvlaeaggipvilvlnKiDllddeeleellelldelslgldvvavsaktglgidellellkglkvvl
00357861   1/1  -----------------------kkdklfkillvGdsgvGKTtLlnrllgdeflveyiptigidfytktv
00469361   1/1  -------------------------MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgtt
00525021   1/1  ------------------------eldkllkvvlvGdpnvGKssLlnrllg.dvfvsdypgttgdflvkt
00492921   1/1  ------------------------ekkirnvaivGhvnaGKtTLlnrLlgekldilseerergitidsaa
00514611   1/1  ------------------------lkkllkvvlvGdpgvGKttLlnrllggefiveyiptigvdfltktv
00431331   1/1  ----ledlldlllllllllllslllkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealel
00495771   1/1  lrylvlaeaagippvlvlnKiDlleeeedlelleellkelesigvdvvlvsakkgalldilldilkgktv
00356411   1/1  ----lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgle......ygpTiginegti
00525281   1/1  -----------------------kkdkllkvvlvGdsgvGKTsLlnrllggefiveyiptigvdfytktv
00525011   1/1  --------------------------kelkvvlvGdpgvGKssLlnrllgge.fvedylpttgddftktv
00407471   1/1  ----------------------------lkvllvGlpnvGKsTLlnrllgdkv...dkpgtTiginlgtv
00374121   1/1  ---------------gellrlslllkkllkvvlvGlpnvGKstLlnrllggdf...depgpTiginfgtv
00444821   1/1  -----------------------elkkllkvllvGlpgvGKttllnrllggefai...ygptiginfgtv
00455591   1/1  -----------------------kkdkllkilvvGdsgvGKttllnrllggefiveyiptigidfytktv
00527351   1/1  ------------------------kdkllkivlvGdsgvGKttllnrllggefiveyiptigvdfltkti
00517691   1/1  --------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllll
00495821   1/1  -------------------------akelkvlllGlsnvGKttllnrl.....kfvety.pTigvnfktv
00387321   1/1  ------------glkglllrlklelkkllkillvGlpgvGKTtllnrllgdefve...ygptiginfvtv
00370451   1/1  -------------------------kkllkillvGdpgvGKstLlnrllgdefiveyiptitvdfltktv
00410321   1/1  -----------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp...eygptiginvgtv
00520051   1/1  ---------------------p..srkelklvvvGdsgvGKTsLlnrllggkf..ekyvptvgvdylktv
00362391   1/1  -------------------------krirnvaivGhvdvGKtTLlnaLlgllgaivgdvallalvldslk
00526801   1/1  -------------------------kkelkvvllGdsgvGKtsLlnrllggefiveyiptigvdfytktv
00481131   1/1  ----------------------------lelkvvlvGdpnvGKssLlnrllggk.fvsdypgttrdfivk
00444161   1/1  ----------------------ekkdklfkillvGdsgvGKttLlnrllgdefiveyiptigvdfytktv
00369581   1/1  ------------------------kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdvadlalvldllk
00372481   1/1  -------------------dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsl
00358141   1/1  -------------------------kkelkvllvGdsgvGKstLlnrllgge.fvedyapttgdditktv
00515621   1/1  --------------------------kelkvlllGlsgvGKTtllnrllgge..fleeygpTigvnfvtv
00520021   1/1  -----------------------lkkkllkivvvGdsgvGKttLlnrllggkfieeyiptigidfytktv
00396721   1/1  -------------------------krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlall
00401211   1/1  -----------------------elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelergitikiga
00514711   1/1  --------------------------kelkvvlvGdpgvGKtsllnrllgdefiveyiptigvdfltktv
00494041   1/1  -------------------------kkeikilllGlgnvGKttllnrllggef...depgpTigvnvttf
00514591   1/1  -------------------------kkllkvvllGdsgvGKTsLlnrllggefiveyiptigvdfytkti
00515511   1/1  --------------------------kgekvlllGlsgsGKSTllnrllglefl....pgpTigptegti
00387311   1/1  -------------------------kkllkillvGdsgvGKtsLlnrllggefiveyiptigvdfltktv
00440861   1/1  ----------MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnva
00378841   1/1  --------------------------kelkillvGdsgvGKstLlnrllgdefiveyiptigvdvytktv
00514601   1/1  -----------------------lkkkllkivlvGdsgvGKTsLlnrllggefiveyiptigvdfytktv
00403151   1/1  --------------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyiptigvdfyvktv
00526151   1/1  -----------------------elkkllkvvllGdsgvGKTtllnrllggkfieeyiptigvdfgtvtl
00374071   1/1  ----------------------lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagel
00410531   1/1  ---------------gelknlslelkkglkillvGlngvGKTtllkrlaggefv...dygptigvnfktv
00352811   1/1  -----------------------lekkelkilllGlgnvGKsTllnrllggef....ergpTiginvetf
00507921   1/1  ---------------------sskkkkllkivlvGdsgvGKtsLlnrllgdefiveyiptigvdfltkti
00514621   1/1  ------------------------lkkllkvvlvGdsgvGKtsLlnrllggefiveyiptigvdfytktv
00412341   1/1  ------------------------lkkkkllkillvGdsgvGKtsLlnrllggefiveyiptigvdfltk
00362791   1/1  ---------------------------elkilvvGdsgvGKttLlnrllggefiveyiptigvdfytktv
00366991   1/1  ----------------esllkklelkkllkillvGlpgvGKTtllnrllggef...eeyvptiginfvtv
00515531   1/1  --------------------------kgekvallGlsgsGKSTllnrllglefa....ygpTigptsgti
00527641   1/1  ----------------------lkkkkllkivllGdsgvGKTsllnrllggefveeyiptigvdfytkti
00516481   1/1  --------------------lkllelkrirniaiiGhvdaGKsTLlnrLlgetgaidedlllklevlakk
00480471   1/1  -----------------------------sleikkgekvaivGpsGsGKSTLlnaLagllspts.vpett
00411701   1/1  -----------kfslelllalmldlerirniaiiGhvdaGKTTLterLlyytgiiseagevdltvtDtle
00490731   1/1  ------------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaD
00394721   1/1  vvgreealeallealrr........gpprnvlLvGppGvGKTtlakalakelaag...........sgpi
00414121   1/1  -------------------------kpgevvllvGpsGaGKTTLlrallgll...eglkvaviepdfgei
00475371   1/1  ----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrps
00448931   1/1  -----------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla
00402371   1/1  viGqeealeallealrr........rpgrnvllvGppGvGKTtlaralagllvrs...........sgpi
00373851   1/1  ----------rellllllllllllkgkpkviavtsgkGGvGKTTtaanLaaalaerGkkVllvdaDpqas
00504491   1/1  --------------------------rirniaiighvdaGKTTlteaLllytgaiskagevkdgaavlDw


                         -         -         -         +         -         -         -:280
query           FLRGDRVQVIDTPGLLDRPLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFS
00414001   1/1  velpderldllaglakpkklvgapvvlvDtpGlie.gaslgeglgrqflaalee.advilhVvdasdplg
00475471   1/1  elpdgrldllaelvkpkkivpapivlvDtpGlieg.asegeglgnqflaaire.advilhvvdaseglti
00507411   1/1  evdderldllaelslkpalgvkpkkivpakivlvDtpGlikg.aslgeglgnqflaaire.advillVvD
00424711   1/1  l...gkklvliDtPGllefaseleglgkklverflryleeadlvllVvdas..dglseq...........
00409841   1/1  vlldgrdllllDtPGlidfaseptnlldleiieallraleeadvvllvvdad..rglleqdle.llelll
00432181   1/1  veldgrklvliDtpGleefasggekqrvalalallre.advlllvvdadeptsfldlellellrelll..
00498681   1/1  eldgkvkltliDtpGlid.paslqedfrslllrylrg.advillvvdatdlsfedleklleelrellpel
00523461   1/1  le....kltliDtpGllltkllegalldllerflrslllsylrgadvvllvvdatdlesfesvllllglk
00471271   1/1  vtvegkgvkltliDtpGlgd....paslqeefralvlrylrlrgadavllVvdatdpglfeqdlellkel
00405881   1/1  elddgrqlvlvDtpGliel.aslgeglvrqalealerad.villvvdasdplldqpvellsggekqrlal
00494851   1/1  gvl...gvkltliDtpGlgdldviielaerlrdlvreylralrgadgvllvvdatd...glfeqdlellk
00484261   1/1  tveldgvklnliDtpGqed....frslverylrgflee.adgvllVvdat.edregfeeqtkellellrl
00467111   1/1  gvpgtTrdiwmwivvlieldgrpllliDTpGlgdtekedekelvkiallalll.advvllvvd.....gg
00517841   1/1  gespellaeflidggekltdldelrkeieeatdallgpgkgfsfdtieleielpdlpnltlvDtPGlgsa
00511561   1/1  velkgvklvliDtpGlidgalelqerflslrvlrylrgadvvllvvdatd...glfeqleellellr...
00492691   1/1  tveldgklvkltlwDtpGqerf.rslrklyyrgaleailllllglllleleeadvvllVvdat..dresf
00518321   1/1  vdfnvktveldgkkvklqlwDtpGq...........erfrslrllylrgadvvllVvdat..dresfeev
00514721   1/1  eldgklvklqlwDtpGq...........erfrslrllylrgadvvllVvdat..dgesfeeldewllell
00465511   1/1  .veldgkvkltliDtpGlidgapellqedfralvlrylrgadgvllvvdatd....lleqllelleelle
00529141   1/1  eldgklvklqlwDtpGqe........rfrslrllylrg.advvllvvdatdgesfenlkkwllellelle
00504821   1/1  tveldgkklvliDtpGlidgaselqedfrkltlrylrg.advvllvvdatd..g.lfeqtlellellrel
00514581   1/1  veldgkkvklqlwDtaGqerfrdslrely........lrgadvvllvvdat..dgesfedlkkwleelle
00470231   1/1  ....kivsdpgtTigv.vgtveldgvklqlwDtaGq...........erfrsltlrylrgadavllVvDa
00481541   1/1  veldgklvklqlwDtpG...........qerfrslrllylrgadvvllvvdat..dgesfeeldeellel
00481801   1/1  veldgvkltliDtpGlidgaseglqedfrslllrylrgadvvllvvdatd...glleqdlellellrel.
00488191   1/1  .tveldg.kltliDtPGlgdllviielaslledfrsltlrylrgadvvllvvdatd...glleqtlelle
00511041   1/1  eldgkkvklqlwDtpG...........qerfrslrllylrgadgvllvvdatdpesfeglkkwllellel
00442331   1/1  eldgkkvklnlwDtpGqedfrslvelylrg.........adgvllVvdatdresfegvkkwleeilrllp
00515821   1/1  veldgvkltlvDtpG...........qedfrslvlrylrgadgvllVvdatdresfegveeqleellell
00520981   1/1  veldgkkvklqlwDtpGq...........erfrslrllylrgadvvllvvdat..dresfeevdewllel
00531961   1/1  eldgktvklqlwDtpGqer........frslrllylrg.advvllVvdat..dgesfedlleelleelre
00526911   1/1  velkdgklvkltliDtpG..........qedfraellrsylrgadgillVvdatdp..esgfeeltkell
00517041   1/1  eldgklvklqlwDtpG.qerfrsllely........lrgadvvllvvdat..dgesfedlekwleellel
00527241   1/1  eldgklvklqlwDtpG...........qerfrslrllylrgadgvllVvdatdpesfeglkkwllellel
00528321   1/1  tveldgkkvtllllqiwDtpGqerf...........ltllylrgadvvllvvdat..dgesfedlkkwle
00514481   1/1  veldgvklvlvDtpGqedf........rrltlrylrg.adgvllvvdatdresfegveeqleellellll
00528791   1/1  eldgklvklqlwDtpG...........qerfrslrllylrgadvvllVvdat..dresfedlkewleell
00399991   1/1  eldgktvkltlwDtpGqeefrslrerylrg.........adgvllVvdatdresfeglkkwleeilelll
00517931   1/1  eldgvkltlvDtpG...........qerfrslrllylrgadgvllvvdatdrdsfeglkeqllellelll
00528591   1/1  .gtTiginfgtveldgvkltlvDtpG...........qedfrslrlrylrgadgvllVvdatdresfegv
00519271   1/1  iginfgtveldgvklvlvDtpGqedf.........raltlrylrgadgvllvvdatdresfegveeqlee
00507751   1/1  eidgklvklqlwDtaG........qerfrslrllylrg.advvllvvdvt..dresfedlkkwleeilel
00463921   1/1  veldgklvklqlwDtpG...........qerfrslrllylrgadvvllvvdatdre..sfeeldeellel
00477011   1/1  setpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdltlv
00515101   1/1  ..titidigtveldgvkltlvDtpGqedf........rrltlrylrg.adgvllvvdatdresfegveeq
00514501   1/1  eldgkevklqlwDtpGqe.rfrsllely........lrgadvvllvvdat..dgesfedlkkwleellel
00378621   1/1  eldgvklqlwDtpGq........erfrsltlrylen.advvllvvdas..dpdsfeellelleellelll
00447401   1/1  eidgkrvklllwDtpGqeefrsllelylrg.........adgvllVvdat..dpesfenlkkwleellel
00518311   1/1  eldgklvklqlwDtpG...........qerfr.ltllylrgadvvllvvdatdresfeglkkwllellel
00402391   1/1  eldgvklqlwDtpGqerfrsl.........tllylrgadgvllVvdasdgd....sfeellkwleellel
00361531   1/1  eldgkkvklnliDtpGqeefrslrerylrg.........adgvllVvdatdgesfeelkewleeilellp
00526251   1/1  eldgktvklqlwDtaGqer........frslrelylrg.adgvllvvdvt..dpesfedlkkwleellel
00528411   1/1  veldgkkvklvlwDtpG...........qerfrslrllylrgadvvllVvdatdgesfedlkkwleelle
00513761   1/1  peqlgidirdlidletvmelglgpngalvfaleellttldillealelleedydyiliDtpGgle..lra
00519521   1/1  eiggvkfrlwDtgGq........rrfrklwllyfed.adaiifvvDasdydqvlledelrnrleellell
00504231   1/1  dialvilelkgrklnliDtPGh........edfsslvlral.rvadgallvvdatd....gvtpqtlevl
00527851   1/1  tveldgklvklqlwDtpG...........qerfrslrllylrgadvvllvvdat..dresfeeldewlle
00449901   1/1  eldgkkvkltlwDtpGqeefrslrelyyrg.........adavllvvdat..dpesfenlkkwleellel
00497591   1/1  vGrsgvGKStLlnallgekvakvsdisatlgrgpgttrdiilikl...drgllliDtPGiref..gllde
00357861   1/1  eidgkkvklqiwDtaGqer........frslrslyyrg.adgvllvyditdgesfeelkkwleellrlap
00469361   1/1  rldsleeerergitidsglvkfelnglnliDtPGhed........frsltlrylrg.adgallVvdatd.
00525021   1/1  veldgklvklqlwDtpG...........qerfrslrllylrgadgvllVvdat..dgesfedlkkwleel
00492921   1/1  ttleldgrdlllllllgklllllllslellkqlnliDtPGhed........fssevlralrv.adgallV
00514611   1/1  evdgkkvklqlwDtaGqerfrslrelyyrg.........adgvllvvdvt..dresfedlkkwleellel
00431331   1/1  gkgslllalvldsldeErergiTidiaavsfetdgrkitliDtPGhed........fikevirgl.svad
00495771   1/1  alvGpsGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirle..g..lvliDtpGfrdtileni
00356411   1/1  eidgvkltlwDtgGq........esfrklwilyfeg.adaiifvvdasdrdsflnld..kwrnrlgevlq
00525281   1/1  evdgkkvklqlwDtaGqerfrslrelyyrg.........adgvllVvdvt..dresfenlkkwleellel
00525011   1/1  evdgktvklqiwDtaGq........erfrsltelyyrg.adgvllvydvt..dresfedlkkwleellel
00407471   1/1  eldgvkltlvDtpGq....erfrsl.....wlrylegadavilvvdasdpdsfeelkelleellelllla
00374121   1/1  eldgvkltliDtpGqeefrsl.........tlrylrgadgvllVvdasdgdsfeevlelleellelllla
00444821   1/1  eldgvklqlwDtaGqerfrslwllylrg.........adavllVvdat..dgdsfeelkellleilelll
00455591   1/1  evdgkkvklqlwDtaGqer........frslrelyyrg.adgillvydvt..dresfeelkkwleeilrl
00527351   1/1  eldgkkvklqlwDtaGqerfrslrelyyrg.........adgiilVydvt..dresfenlkkwleellel
00517691   1/1  gllsfllalvldslplerergitidvalarllldgrkilllDtPGhed........fvkevlralrl.ad
00495821   1/1  eidgvklqiwDtaGqer........frslwllyyrg.adaiifVvDlsdrdqvlledelvnsfeevlewl
00387321   1/1  dlkgvklqlwDtaGqerfrslwllyyrg.........adgillVvdat..dgdsfeevaklleeilelag
00370451   1/1  eldgklvklqlwDtaGqer........frslrelylrg.adgvllvvdat..dresfedlkkwleeilel
00410321   1/1  eldgvklqlwDtaGqerfrsllllylrg.........adgvllVvdat..dgdsfeevkellleilelag
00520051   1/1  evdgklvrlqlwDtpGqerfr.............yyrg.adgvllvfdls..dpesfenlkkwlkellel
00362391   1/1  eerergiTidigavtletdgrlitliDtPGhvd........fvkevlrglrv.adgailVvdav....eg
00526801   1/1  evdgkkvklqlwDtaGqerfrslrelyyrg.........adgvilVydvt..dresfenlkkwleellel
00481131   1/1  tveldgklvklqlwDtaG...........qerfrsllelylrgadvvllVvdatdresfeeldeelleel
00444161   1/1  evdgktvklqlwDtaGqer........frslrelyyrg.adgvllVydvt..dresfenlkkwleeilrl
00369581   1/1  lerergitidiglvsleldglkitliDtPGhedflke.........vlrglavadgallVvdategvlp.
00372481   1/1  eeerergitidsgavsletdgrkinliDtPGhed........fskevlrglav.adgallVvdaa....d
00358141   1/1  eldgkkvkltlwDtaGqer........frslrelylrg.adgvllVvdvt..dgesfeelkkwleeilnl
00515621   1/1  dlkdvklqlwDtaGqer.........frslwelyyrgadgvilVvdatdrd..sfeevkkwleellelal
00520021   1/1  evdgkkvklqiwDtaGqerfrslrelyyrg.........adgvilvydvt..dresfenlkkwleeilel
00396721   1/1  gkgsfllllvldsldeerergitidiaavsfetkgrkltliDtPGhed........frkevirglrv.ad
00401211   1/1  asllldklaivsdtpgttldpilgvleldgpkllllDtPGhed.........flkellralaladgallv
00514711   1/1  evdgktvklqlwDtaGqerfrsl.........telyyrgadgvllVvdvtd..resfenlkkwleellel
00494041   1/1  tlkgvklqlwDtgGqe........rfrslwelyfeg.adaiifvvdlsdgdsflnldkwlnrleeslell
00514591   1/1  evdgkkvklqiwDtaGqerfrslrelyyrg.........adgvilVydvt..dresfenlkkwleellel
00515511   1/1  eidgvklqlwDtgGqer........frslwllyfeg.adaiifvvdlsdgdsllalrrwigrlfqslnll
00387311   1/1  evdgkkvklqlwDtaGqerfrslrelyyrg.........adgvllvydvt..dresfedlkkwleeilrl
00440861   1/1  lvGpsGsGKStLlnaLlgllkpdegvilvggk.gvTrdivlytle.dgvkltliDtpGlgdtklsdeekl
00378841   1/1  eidgkkvklqlwDtaGqerfrsllelyyr.........gadgillvvdvt..dresfeelkkwleeilrl
00514601   1/1  evdgkkvklqlwDtaGqerfrslrelyyrg.........adgvllvydvt..dresfenlkkwleellel
00403151   1/1  eidgkklvkltlwDtaGqerfrslrelyyrg.........adgvllvydvt..dresfenvlswleelre
00526151   1/1  eledlylklvlvdgknvklqlwDtaGqerfrslrplyyrg.........adgvilVydvt..dresfenl
00374071   1/1  gkgslllaavldsleeerergitidiaavsfetdgrkitliDtPGhvd.........fikevirglsvad
00410531   1/1  evdgvklviwDtaGqerfrsllarylrg.........adgillvvdat..dglsfeevaklleellglag
00352811   1/1  eidgvkftiwDtgGqrd........frklwilyfeg.adaiifVvdssdydsflnvdkwtnrleealell
00507921   1/1  evdgkkvklqlwDtaGqerfrslrelylrg.........adgvllVydvt..dresfedlkkwleellel
00514621   1/1  evdgkkvklqlwDtaGq........erfrslrelyyrg.adgvilVydvt..dresfedlkkwleellel
00412341   1/1  tvevdgkkvklqlwDtaGqerfrslrelyyrg.........adgiilvydvt..dresfenlkkwleeil
00362791   1/1  evdgkkvkltlwDtaGqerfrslrelyyrg.........adgvllvydvt..dresfedlkkwleellkl
00366991   1/1  eikgvklqlwDtaGqerfrslwllylr.........gadgillVvdat..dgdsfeevakwleellnlag
00515531   1/1  eidgvklqlwDtgGqerfrs........lwilyfed.adaiifvvdlsdrdsflelrrwigrlfqdlnlf
00527641   1/1  evdgknvklqlwDtaGqerfrslrplyyrg.........adgiilVydvt..dresfenlkkwleellel
00516481   1/1  lgevddglllaivldklelerergitidsaavsfetdgrkinliDtPGhed........fvkevlrgl.r
00480471   1/1  rdfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllell
00411701   1/1  dEreRgiTikssatslewelieelllelkldidgkgylinliDTPG........hvdFsseveralrvaD
00490731   1/1  pyrpaadellgvlaeelgldvllgarggdlsgglrqr.larallgdydvliiDtpgtldvllelallell
00394721   1/1  lldgvpvvrldlsellsvsdlvgelegglrglltealalakpsvlflDEidrlldardsesslevlnaLl
00414121   1/1  lidgqlledlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilidsgGqkq......rlal
00475371   1/1  arellgllgellgldvlvgarggdlsgglrqr.larallgdpdvlliDepgrgldpellallaelldllr
00448931   1/1  areqlgivfqdpgltvlenlalgeleararellellgledydvvliDtag.rlrlpselsggqkqrvaia
00402371   1/1  lldgvpfvrldasellefgkyvgafegglrqllglaraakpgvlflDEidsllgarggsgvdpevqnaLl
00373851   1/1  lsdllglegerlpvtvidvlrgledledlivepgldllpagllaeleellasrgadeaallrellellka
00504491   1/1  melEkergitikssavslewkgylinliDTPGhvd........FseeveralrvlDgavl.vvdaveG..


                         -         *         -         -         -         -         +:350
query           APAVAVLNKIDIATEEELEKARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALEKLRAAARGR----
00414001   1/1  iilvvnkvdpledieiisaelgladlellekllealirrpnsgkssllnk--------------------
00475471   1/1  vhveglvdplrdieiilleliladlellekrleklgklakggvkdlleal--------------------
00507411   1/1  asegltliihvegsvdPvedieiietELiladlellekrleklekkaklg--------------------
00424711   1/1  ..gkpvivvlNKiDlleaeeleelkkllkflglllegepgdavlapvv----------------------
00409841   1/1  el.gkpvilvlNKiDlldaeellleevleellkllaelggvpvvpiSaltgegvd---------------
00432181   1/1  agkpvilvlnKiDlldar.eelakllgvpvvevSaktgegvdellealaelllen---------------
00498681   1/1  lgvpiilvlNKiDlldaeeleelkellkllgipvvevsaktgegvdelleallelllelllllll-----
00523461   1/1  eqllellkllellgvpiilvlnKiDlladaeeveellaellellgllgdipvv-----------------
00471271   1/1  lelfgelagvpiilvlNKiDlldaeev.eleeeiaellalllklgelgllllndlll-------------
00405881   1/1  arallgkpvilvlNKiDeptneldlellelleelggtvvlvSahdge-----------------------
00494851   1/1  llle.lgvpiilvlNKiDlldeaelevlleelrellkelglvpvvpvsak--------------------
00484261   1/1  lglllllgvpiilvlNKiDlldareveevleelkeelkalakelglpigl--------------------
00467111   1/1  iteqdlellklllelg.kplilvlnKwDllekeeleellkelkplllflvr-------------------
00517841   1/1  avgdqpeeleeafraltleylreadtlillvvdasd..dltesdalkl----------------------
00511561   1/1  gvpiilvlnKiDlldarellelllalllglpvvevsaktgegvdelle----------------------
00492691   1/1  eeldlellellrellpgvpiilvgNKiDlldarellelllllglllvsleeilela--------------
00518321   1/1  deellellrelglgvpiilvgnKiDlldarellellellglllvsleealela-----------------
00514721   1/1  relgpgvpiilvgnKiDlldarellellellglglvsleealelakelglvpvv----------------
00465511   1/1  l.gvpiilvlNKiDlldarevsleeleelakklglvpvvevsaktgegvdelleallel-----------
00529141   1/1  lagipiilvgnKiDllearevsleellelakelglpvievSaktgegvdelfealae-------------
00504821   1/1  lpgvpiilvlNKiDllddrevlleelrellg.lvpvvevsaktgegvdelfeallellp-----------
00514581   1/1  llklagvpiilvgnKiDllearevsleellelakelglpvietSakd-----------------------
00470231   1/1  sdydlvllepdsferleewleelrellanpllanvpiilvgNKiDl....l-------------------
00481541   1/1  lrellagvpiilvgnKiDlldarellellellglllvsleealelakelgavpvv---------------
00481801   1/1  gvpiilvlNKiDlld.vlleeleellkelglppvvpvsaktgegvdelleallellle------------
00488191   1/1  ellel.gvpiilvlNKiDlldaeeleevveeleelllalglgipvvevs---------------------
00511041   1/1  lelagvpiilvgnKiDlledrevsleellelakelgipvvetSaktgegvde------------------
00442331   1/1  lanvpiilvgnKiDllearevseeealelakelglpvvetSaktgegvdelfeallkl------------
00515821   1/1  kllgvpiilvlNKiDlldaeelrevleelaellakelgipvvetSaktgegv------------------
00520981   1/1  lrelglnvpiilvgnKiDlldarellellellglllvsleealelakelga-------------------
00531961   1/1  llpgvpiilvgNKiDlldarellellellelglvsleellelakelgavpvve-----------------
00526911   1/1  ellrelgllagvpliilvlNKiDlldareveelleelreelkklakelgllle-----------------
00517041   1/1  leagvpiilvgNKiDlldarevsleealelakelglpvietSaktgegvdelfealaell----------
00527241   1/1  lelagvpiilvgnKiDlleerevsleellelakelglpvvetSaktgegvd-------------------
00528321   1/1  ellellelagvpiilvgNKiDlledrevsleellelakelgipvietSaktgegvd--------------
00514481   1/1  lgvpiilvlnKiDlldareleevleelaellalllgipvvevsaktge----------------------
00528791   1/1  eladllagvpiilvgnKiDlldrevlleeleelakelglpvvetSaktgegvdelfea------------
00399991   1/1  lagvpiilvgNKiDlleerevsleealelaeelglpvvetSaktgegvdelfe-----------------
00517931   1/1  llgvpiilvlNKiDlldalelrevleelaealakelgipvietSaktgegvdel----------------
00528591   1/1  ekqleellellrllgvpiilvlNKiDlleareveellaelellllllll---------------------
00519271   1/1  llelllllgipiilvlNKiDlldaldlrevleelaellakelgipvvetSaktge---------------
00507751   1/1  lelagvpiilvgnKiDllearevsleealelakelglpfietSaktlgegvdelfea-------------
00463921   1/1  lrelgpgvpiilvgnKiDlldarellellellglllvsleellelakelgavpvv---------------
00477011   1/1  DtPGlgsvavvdqlsggqkqrvalarallknpdtlillved.andldt----------------------
00515101   1/1  leellellrllgvpiilvlNKiDlldaeelrevseelaellakllgipv---------------------
00514501   1/1  lgagvpiilvgnKiDllearevsleellelakelglpvvetSaktgegvdelf-----------------
00378621   1/1  lagvpiilvlNKiDlldaallrevleelalelakllgipvvetSAktgeg--------------------
00447401   1/1  lgllllagvpiilvgnKiDlldrevleelaealakelggipvvetSaktgegvdelfealvklllel---
00518311   1/1  lelagvpiilvgnKiDllderevsleellelakelglpvietSaktgegnvd------------------
00402391   1/1  llllgipiilvlNKiDlldalslrevleelalelakllgipvfetSaktgegv-----------------
00361531   1/1  ladvpiilvgNKiDllerevleeeaeelakelglpvvetSaktgegvdelfea-----------------
00526251   1/1  ldsnvpiilvgnKiDllearevseeealelakelglpfietSaktgegvdelfealaell----------
00528411   1/1  lleagvpiilvgnKiDlldarevsleellelakelglpvietSaktgegvde------------------
00513761   1/1  llalllaiaral..aadeillvddptsgldaetqleilelllelllklgipii-----------------
00519521   1/1  eeilnllllagkpillvlNKiDlldekllaelledlfpeykglnndleaa--------------------
00504231   1/1  llllllgvpiivvlNKiDlvdadrleevleeleellkllllpldvpivpisaltge--------------
00527851   1/1  llrelgpgvpiilvgnKiDlldalsllellsllglrevlleealelakelglvpvvetSaktgeg-----
00449901   1/1  ldllllagvpiilvgnKiDllerevlleeleelakelglvpfvetSaktgegv-----------------
00497591   1/1  eaveltllylegadllllvv--------------------------------------------------
00357861   1/1  ..nvpiilvgnKiDlldareveealelakelglpffetSAktgegveelf--------------------
00469361   1/1  .gvsfqtl.ellelllel.gvpiilvlNKiDlvdadeleeleellkklglplelvpllldlll-------
00525021   1/1  lellelagvpiilvgnKiDlleerevsleellelakelglpvvetSaktgegvde---------------
00492921   1/1  vdat..dgvslpqteevlelllel.gvpniivvlNKiDlvdadrleevleelee----------------
00514611   1/1  lepnvpiilvgnKiDlpearevseeealelakelglpfietSaktgegvde-------------------
00431331   1/1  gallVvdasegvlerllelepqtrevlllalllgvphiivviNKiDlldadpl-----------------
00495771   1/1  ekeeleatfeeireadlvllvid-----------------------------------------------
00356411   1/1  llelilnltvlenvpiilvlNKiDlleekiveellellgleykgdrdpee--------------------
00525281   1/1  leanvpiilvgnKiDllearevseeealelakelglpffetSaktgegvde-------------------
00525011   1/1  ldllsnvpiilvgnKiDllderevseeealelakelglpfietSAktgegv-------------------
00407471   1/1  gvpiilvlNKiDlldakllaellellrlvlleellllalllgipvvetSA--------------------
00374121   1/1  nvpiilvlNKiDlldareleellellellllllvsteealelaeelglpv--------------------
00444821   1/1  lagvpiilvgNKiDllealslrevseelalelakllgipvfetSAktgeg--------------------
00455591   1/1  lesnvpiilvgnKiDllderevskeealelakelglpfletSaktgegvdelf-----------------
00527351   1/1  lpsnvpiilvgnKiDlpearevseeealelakelglpfietSaktgegvd--------------------
00517691   1/1  gallvvd...adegvslpqtrevlllllllgvpniivvlNKiDlvdaeeleevl----------------
00495821   1/1  eellnnallanvpillvgNKiDl....leelakklglkvfetsaktgegve-------------------
00387321   1/1  lenvpiilvgNKiDlldalllrevleelglelakelgipffetSAktgegv-------------------
00370451   1/1  lpagvpiilvgnKiDlldalslrevseeealelakelglpfietSaktgegvd-----------------
00410321   1/1  lagvpiilvgNKiDllealgarevseelalelakelgipvvetSAktgeg--------------------
00520051   1/1  lglllpgipillvgtK.Dlledldlrevsleealelakelggvpyfetsaktgegvdelf----------
00362391   1/1  vmpqtrehlllarllgvpkiivviNKiDlvdaderlelvveellellkklglllelvpvvpvS-------
00526801   1/1  apanvpiilvgnKiDllearevseeealelakelglpfietSaktgegvde-------------------
00481131   1/1  relaagvpiilvgnKiDlldalsllllllllglrevlleealelakelglvpvi----------------
00444161   1/1  lpsgvpiilvgNKiDllderevskeearelakelglpfvetSAktgegvd--------------------
00369581   1/1  ...qtrevlllakllgvpniivvlNKiDlvdaeerleevleelrellkll--------------------
00372481   1/1  gvspqteevlllarllgvpkiivvlNKiDlldadelleevkeelrellkllgllledv------------
00358141   1/1  lpladvpiilvgnKiDlleerevseeeglelakelglipfvetSaktgegv-------------------
00515621   1/1  lagvpillvgNKiDlldalslrevseeealelakelgipvfetSAktgegv-------------------
00520021   1/1  lesnvpiilvgnKiDlpearevseeealelakelglpfietSAktgegveelfealvr------------
00396721   1/1  gailVvdasdgesfagievepqtrellllarllgvphiivviNKiDlldadelee---------------
00401211   1/1  vdadegeflpqtlevlllllelgv...kpiilvlNKiDlvdaelleevle--------------------
00514711   1/1  aedvpiilvgNKiDlldarevseeealelakelglpvfetSaktgegvdel-------------------
00494041   1/1  esilnllllanvpillvgNKiDlleaklleellkllfpeydglndledal--------------------
00514591   1/1  apsnvpiilvgnKiDlldarevseeealelakelglpffetSaktgegveelf-----------------
00515511   1/1  esllvlenlanvpillvlnKiDlleaklvllllvglfdlldglpselsg---------------------
00387311   1/1  ldpgvpiilvgnKiDlleerevseeealelakelglpfvetSaktgegvd--------------------
00440861   1/1  ilkyl....eeadlvllvid.dglteldlellkllkel.....gkpvilvlnkiDllkkeelekl-----
00378841   1/1  leagvpiilvgnKiDllgrqvlveearalakelgiplfetSaktgegvdel-------------------
00514601   1/1  apsnvpiilvgnKiDlpearevseeealelakelglpffetSaktgegvdelf-----------------
00403151   1/1  llgllllegvpillvgnKlDlptnerdvsleealelalelgllpvievSak-------------------
00526151   1/1  kkwleellelaelpnvpivlvgNKiDlpdarevseeeaeelakelglpffe-------------------
00374071   1/1  gallvvdavegefeaglsvepqtrevlllalllgvphiivviNKiDlvdadee-----------------
00410531   1/1  legvpiilvgnKlDlldalllrevsaelalelakelgikfietSAktgegv-------------------
00352811   1/1  esillnrllknvpiilvlNKiDlleeksveeilelleyfpdylgllklld--------------------
00507921   1/1  lelpdvpiilvgnKiDlldrevseeealelakelglpfietSaktgegvdelfealve------------
00514621   1/1  le..pgvpiilvgnKiDlldarevseeealelakelglpfietSaktgegv-------------------
00412341   1/1  rlldpgvpiilvgnKiDlleerevseeealelakelglpfvetSAktgeg--------------------
00362791   1/1  lesgvpiilvgnKiDlldarevseeealelakelglpfletSAktgegvd--------------------
00366991   1/1  ladvpillvgnKiDllealsarevseeealelakelgipfvetSAktgegv-------------------
00515531   1/1  psltvlenlanvpillvlnKiDlleakeraeellellglgdlldklpsels-------------------
00527641   1/1  ldpnvpivlvgnKiDlpdarevseeealelakelglpffetSaktgegvee-------------------
00516481   1/1  vadgallVvdateg....vepqtrevlllarllgvpriivvvNKiDlvga--------------------
00480471   1/1  kelkyd...pvilllnkidllddrllrraeaeerieellelv----------------------------
00411701   1/1  gail.VvDave....gvepqteevlrqarkegipiilviNKiDrlga-----------------------
00490731   1/1  ke...llaelgadvvllvvdat....lgleaadr.ilvlleglgvp.gvvl-------------------
00394721   1/1  rlledg.nvlv-----------------------------------------------------------
00414121   1/1  aralladpdlgellllDeptlvlDaas.....gedlldllkelaeqlgltvli-----------------
00475371   1/1  el.radlgllvvdath.dldavlkaadrilvldlg.....givlnkldlv--------------------
00448931   1/1  ralaaplppevllldeptsgldalr---------------------------------------------
00402371   1/1  rlleeg.nvrviaatnrpelvklgeldpallrRfdvielplpdleerleilklllekllkrlglel----
00373851   1/1  gdyDvviiDtppglgt------------------------------------------------------
00504491   1/1  ..vepqtetllrlarkygvpiivfiNKmD-----------------------------------------