[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL65069.1


[Show Plain Result]

## Summary of Sequence Search
   1::315
   4::312  6.9e-42 27.8% 0038952 00389521 1/1   ependent transferases                   
  35::312  3.5e-39 28.9% 0050390 00503901 1/1   ependent transferases                   
  35::310  2.7e-37 28.0% 0052862 00528621 1/1   ependent transferases                   
  18::310    4e-37 29.7% 0047956 00479561 1/1   ependent transferases                   
  35::312  6.8e-37 30.6% 0035401 00354011 1/1   ependent transferases                   
  35::312  1.8e-36 26.6% 0037569 00375691 1/1   ependent transferases                   
  35::312  1.9e-36 27.1% 0039341 00393411 1/1   ependent transferases                   
  35::312  4.1e-36 29.9% 0035589 00355891 1/1   ependent transferases                   
   9::312  5.7e-36 28.3% 0046024 00460241 1/1   ependent transferases                   
  35::312  5.4e-35 25.9% 0050696 00506961 1/1   ependent transferases                   
  34::310  5.7e-35 28.7% 0044595 00445951 1/1   ependent transferases                   
  35::312  8.5e-35 26.6% 0050768 00507681 1/1   ependent transferases                   
   9::312  1.6e-34 29.1% 0046089 00460891 1/1   ependent transferases                   
  14::315  1.8e-34 27.7% 0050977 00509771 1/1   ependent transferases                   
  35::312  2.8e-34 28.2% 0051323 00513231 1/1   ependent transferases                   
  35::312    3e-34 28.3% 0041674 00416741 1/1   ependent transferases                   
   8::316  9.6e-34 27.8% 0050261 00502611 1/1   ependent transferases                   
  35::312  1.5e-33 28.4% 0046965 00469651 1/1   ependent transferases                   
   1::308  1.9e-33 25.3% 0044523 00445231 1/1   ependent transferases                   
   6::306  7.6e-33 25.3% 0045171 00451711 1/1   ependent transferases                   
  35::310  4.7e-32 27.6% 0046255 00462551 1/1   ependent transferases                   
  35::306  2.7e-31 28.4% 0045639 00456391 1/1   ependent transferases                   
  37::311  7.9e-31 29.4% 0049754 00497541 1/1   ependent transferases                   
  35::306  2.1e-30 24.6% 0045231 00452311 1/1   ependent transferases                   
  14::309  6.4e-30 28.6% 0053335 00533351 1/1   ependent transferases                   
   6::297  1.9e-29 25.6% 0042806 00428061 1/1   ependent transferases                   
  34::309  1.4e-27 24.5% 0035073 00350731 1/1   ependent transferases                   
  34::306  3.6e-27 27.5% 0045068 00450681 1/1   ependent transferases                   
  30::311  4.3e-27 25.6% 0040526 00405261 1/1   ependent transferases                   
  30::316  1.2e-25 24.7% 0046165 00461651 1/1   ependent transferases                   
   5::310  6.3e-23 27.5% 0041260 00412601 1/1   ependent transferases                   
  37::306  1.2e-22 25.8% 0050754 00507541 1/1   ependent transferases                   
   6::313  5.4e-22 25.6% 0050157 00501571 1/1   ependent transferases                   
  37::310  6.7e-22 25.0% 0049486 00494861 1/1   ependent transferases                   
  35::312  1.3e-21 24.8% 0044807 00448071 1/1   ependent transferases                   
  37::308  1.3e-20 29.2% 0048952 00489521 1/1   ependent transferases                   
  37::306  1.8e-20 28.0% 0036780 00367801 1/1   ependent transferases                   
  37::294  2.2e-20 25.4% 0048747 00487471 1/1   ependent transferases                   
  37::308  3.2e-20 26.2% 0038034 00380341 1/1   ependent transferases                   
  37::312  6.8e-20 26.6% 0051195 00511951 1/1   ependent transferases                   
  17::310  7.2e-20 26.3% 0047441 00474411 1/1   ependent transferases                   
  37::306  9.4e-20 23.7% 0050753 00507531 1/1   ependent transferases                   
  31::316  1.3e-19 25.6% 0048074 00480741 1/1   ependent transferases                   
  37::305  3.1e-19 27.5% 0040134 00401341 1/1   ependent transferases                   
  37::310  3.9e-18 26.0% 0036406 00364061 1/1   ependent transferases                   
  37::306  5.1e-18 27.0% 0042144 00421441 1/1   ependent transferases                   
  10::312    1e-17 25.3% 0041704 00417041 1/1   ependent transferases                   
  26::315  1.2e-17 27.4% 0048571 00485711 1/1   ependent transferases                   
   8::312  2.9e-17 27.4% 0046547 00465471 1/1   ependent transferases                   
  37::310  4.2e-17 27.0% 0051757 00517571 1/1   ependent transferases                   
   3::306  4.6e-17 26.2% 0047340 00473401 1/1   ependent transferases                   
   5::305  2.8e-16 24.6% 0052070 00520701 1/1   ependent transferases                   
  11::310  1.5e-15 24.6% 0040897 00408971 1/1   ependent transferases                   
  34::306    9e-15 24.8% 0052302 00523021 1/1   ependent transferases                   
  37::227    2e-14 23.5% 0046206 00462061 1/1   ependent transferases                   
   5::312  3.3e-14 23.5% 0046007 00460071 1/1   ependent transferases                   
   1::310  4.6e-14 25.1% 0044083 00440831 1/1   ependent transferases                   
   4::312  1.5e-12 19.7% 0047095 00470951 1/1   ependent transferases                   
  31::291  8.1e-12 24.2% 0045973 00459731 1/1   ependent transferases                   
  37::306  1.4e-11 23.7% 0049070 00490701 1/1   ependent transferases                   
  37::310  1.7e-11 19.7% 0052164 00521641 1/1   ependent transferases                   
   6::306  2.3e-11 26.2% 0050076 00500761 1/1   ependent transferases                   
  39::312  4.1e-11 24.4% 0042383 00423831 1/1   ependent transferases                   
  37::310  5.8e-11 22.4% 0046056 00460561 1/1   ependent transferases                   
  37::294    7e-11 22.9% 0049524 00495241 1/1   ependent transferases                   
  37::308  1.4e-10 22.6% 0046584 00465841 1/1   ependent transferases                   
  37::312  8.4e-10 24.0% 0045392 00453921 1/1   ependent transferases                   
 111::312    4e-09 27.5% 0046087 00460871 1/1   ependent transferases                   
  11::310    1e-08 23.5% 0046747 00467471 1/1   ependent transferases                   
  37::314    1e-07 25.1% 0047670 00476701 1/1   ependent transferases                   
  37::197  2.5e-07 23.6% 0042809 00428091 1/1   ependent transferases                   
   1::199    2e-06 21.4% 0035846 00358461 1/1   ependent transferases                   
   1::305    4e-06 23.3% 0046154 00461541 1/1   ependent transferases                   
  29::299    6e-06 24.6% 0045909 00459091 1/1   ependent transferases                   
 111::300  6.6e-06 24.5% 0035246 00352461 1/1   ependent transferases                   
  37::280  0.00018 25.4% 0052731 00527311 1/1   ependent transferases                   
   1::315


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYEIEMFKWIREKNGVYDLASSGVLKLEAPQAEAPPLEEVLIELYDIPRQNLAIVSGAQEGNFLAFLAVK
00389521   1/1  ---mssflstllsprlkslkpyvigellelaaelgaggpdvidlgigepdlgtpplelllltlvlpavle
00503901   1/1  ----------------------------------pelreaiaellgrrygvdvdpeeeilvtnGgteale
00528621   1/1  ----------------------------------ladrlknlppsitlallalalellaggkdvidlsvg
00479561   1/1  -----------------llppspilsllelaaelgaggkdvidlsvgepdfppppavlealaealdgllr
00354011   1/1  ----------------------------------pelreaiaellarrygllvgvdpeeilvtnGateal
00375691   1/1  ----------------------------------pelreaiaellgvdpeeilvtnGatealalllrall
00393411   1/1  ----------------------------------pelrealaellgarygvavdpeeivvtnggtealll
00355891   1/1  ----------------------------------pelrealaellgarygvavdpeeivvtnggtealel
00460241   1/1  --------mmdlssrlerlppsvirkllelaardaggpdvidlgigepdfppppavlealaealdelldg
00506961   1/1  ----------------------------------pelreaiaeylgrrrgvdvdpeqilvtnGatealel
00445951   1/1  ---------------------------------lelssrldglpaslirellelaggpdvidlgvgepdl
00507681   1/1  ----------------------------------pelreaiaeylarrrgvpdpeqilvtnGatealall
00460891   1/1  --------mmllsdrlldlkpsvilkllalaaelgaggpdvidlgigepdfppppavlealaealdegll
00509771   1/1  -------------smdlserlsrlpsyireilelaaelgadgkdvidlgvgepdlldfppppavlealae
00513231   1/1  ----------------------------------pelreaiaeylarrygvgvdpeeeilvtnGateala
00416741   1/1  ----------------------------------pelreaiaellgrrrgvavdpeevvvtnggtealel
00502611   1/1  -------lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepdlglgpppavleala
00469651   1/1  ----------------------------------pelreaiaeyllrrrgvgvdpeteilvtnGateala
00445231   1/1  llellaaellaggpdvidlsvgepdfppppavlealaealddgvlgyypdpglpelreaiaellgrryvd
00451711   1/1  -----lfsrlkalppdpilallalaaedpgpdvidlgvgvyldlepdlppppavlealaealedgltlgY
00462551   1/1  ----------------------------------vidlsvgepdfppppavlealaealdgllgyypsag
00456391   1/1  ----------------------------------pelreaiaelllrrygldldpdrivlvqtlsttGat
00497541   1/1  ------------------------------------nmllserldrlppsailelleladgpdvidlgsg
00452311   1/1  ----------------------------------pelreaiaellfgryglgldpdriatvvtnGateal
00533351   1/1  -------------lfkrlgrlppspirgllalladldgkdvidlgvgiyldpepdlppppavlealaeal
00428061   1/1  -----lfsrlkalppspilklleaakrlggpdvidLgvgvyldlepdlppppavlealaealeegllhgY
00350731   1/1  ---------------------------------lpelreaiakllfgryglaldperiatvvtnGgteal
00450681   1/1  ---------------------------------lpelreaiaelllgeygvgldpervaivvtnGateal
00405261   1/1  -----------------------------pnpglpeLreaiaallggvyglavdpenivvtaGatealsl
00461651   1/1  -----------------------------kldtllvhagrlldlgtggidliilstgeppfpvpeavlea
00412601   1/1  ----ealellalgtdvihlgsnenplgavappiyqtptfvldalaealdggrygrgpnpgleeleealae
00507541   1/1  ------------------------------------laerlaellgadaa.ivftsggteAnllallaar
00501571   1/1  -----leellelleslllsllyrlplvivraegayltdvdgrryldlssglpvnplGhsppevlealaea
00494861   1/1  ------------------------------------lrealaellgaeaaeivftsgGteAnllallall
00448071   1/1  ----------------------------------eelrealaellgadpayevvftsggtealeaallal
00489521   1/1  ------------------------------------mdlsklldrletlalhagllpdvllatgadvipl
00367801   1/1  ------------------------------------leeklaeleg.ae.ealvtssgtaAieaallall
00487471   1/1  ------------------------------------deleealaellga..eealvtssgteAlelalla
00380341   1/1  ------------------------------------leealaellg..aeaalvtssgtaAillallall
00511951   1/1  ------------------------------------leealaellg..aeealvtsggtaaillallall
00474411   1/1  ----------------iyldgpgptplppevlealarallshrsyeftagleelrealaellgadpdvvl
00507531   1/1  ------------------------------------lqerlaellgadaanvvltdggtaaleaallalr
00480741   1/1  ------------------------------iyldnagptplppavlealleglghrsgygytelleelre
00401341   1/1  ------------------------------------leerlaelfgae.aalvftnsGtaAnlaallall
00364061   1/1  ------------------------------------leerlaelfgae.aailltnsGtaAnlaallall
00421441   1/1  ------------------------------------lrellaellgadpaeivftsggtealelallalr
00417041   1/1  ---------Pevlealaevlesg..wlygtgpgveeleealaellgae..eavftssgteAlnlallalg
00485711   1/1  -------------------------lelslpllltelpglsselllelllslllslyaplplvivraega
00465471   1/1  -------dliyldnaaptplppevleamaealeklygnpssghelgygatelleelrealaellgadpde
00517571   1/1  ------------------------------------leellaelfga..eaalvtssgtaAillallall
00473401   1/1  --ealgkdliylgsgapglgtppvvraaaeaaadlfanplsggeysrganptleeleealaellgae..e
00520701   1/1  ----avleavlealekygvgsggsrlsygttelleeleealaellgae..evlltssGteAneaallalr
00408971   1/1  ----------iplplgepdfpeevleaviealdsgg...ytrgpgvaeleealaellg..aehavatnsg
00523021   1/1  ---------------------------------mkfetlllhagldpdpltgavnppiylsstpvfdtpe
00462061   1/1  ------------------------------------rqvggivlilsenappfyvpeavldalteayaeg
00460071   1/1  ----evveaaaealdklglgsggsrllygtnplheeleealaellgae..aallfnsGteAnlaalkall
00440831   1/1  lgslpepevgaqgepieliageeyldalvgaglinlghghpdvvidLlsdtltgpvltaqlaellpgdry
00470951   1/1  ---llllllfpllllfpllkgliyLdnagptplppevleamlealihhlgpeftelveearellaellga
00459731   1/1  ------------------------------dkllsellelllaagllrldpeifsalrkelkrgkdlinl
00490701   1/1  ------------------------------------lrerlaellgadpaeivftssgtaalnaallalg
00521641   1/1  ------------------------------------arellaellgadpyeeivftgggtealeaallnl
00500761   1/1  -----gtehidflsdnptgphpavlealaeallgddlgygadplveeleeklaellgae.aavlftsgGt
00423831   1/1  --------------------------------------smlarllgapadnleealGaftsGgteanlla
00460561   1/1  ------------------------------------lrerlaellgadspdevvftsggtealnlallal
00495241   1/1  ------------------------------------lldlldirllfpalslfalgkdliyldnaattpl
00465841   1/1  ------------------------------------lreklaellgadpeeviftssgtealnlalkalr
00453921   1/1  ------------------------------------laellaellp..ldrvfftnsGseAnelalklar
00460871   1/1  ----------------------------------------------------------------------
00467471   1/1  ----------lllllllllllldeelllllaeelyrlplvivrgegarlldvdgreyidlasnnylglgh
00476701   1/1  ------------------------------------vadwlaellglpvaflllgadpaggvftsGgteA
00428091   1/1  ------------------------------------laerlaellplgldrvfftnsGseAneaalklar
00358461   1/1  fpdfpgpnealea...lgaalggldllygpsggileleealaelfgad.daifvtnGtseanlavilall
00461541   1/1  lselllllleglyevdpeiaeliekelkrqgevllliasenylspavlealgsaltnkyaegypgsryyg
00459091   1/1  ----------------------------ksdliPdfptipeeeieavaealdsgilsytlgpgvkelEea
00352461   1/1  ----------------------------------------------------------------------
00527311   1/1  ------------------------------------kkiplgspvfdeeeiaavlealdsgvytlgptvd


                         -         -         *         -         -         -         -:140
query           PEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNPTGRYLEKRELAELADEARRK
00389521   1/1  alaealdgllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllralldpGdevlv
00503901   1/1  lalralldpGdevlvpdptYpgylaaarlaGakpvfvpldedgllplllglendflldlealeaaitprt
00528621   1/1  epdfppppavlealaealdgllgypppaglpelreaiaeylerrygvgvdpenilvtnGatealflalra
00479561   1/1  ypdpglpelreaiaallgvdpeeilvtnGatealalllralpgdevlvptptYpgylaaarlagaevvpv
00354011   1/1  elalralldpGdevlvpdptYpgylaaarlatgaevvpvpldeeggflldlealeaalteapegglktkl
00375691   1/1  npgdelvlvpdptYpgylaaarlagaevvpvpldedfgldlealeaalpktklvvlpnpnNPtGtvlsle
00393411   1/1  allallgpGdevlvpdptypaylaalrlaGaevvfvpldpdggflldpealeaaitpktklvllvnpnNp
00355891   1/1  alrallgpGdevivpsptypgylaaarllGaevvfvpldpdgtfgldlealeaaitprtkaiilenpnNP
00460241   1/1  agllgYpdpqGlpelreaiaellgrrygvdvdpallkledeivvtnGgtealllalralldpGdevlvpd
00506961   1/1  alrallgpGdevlvpsptYpaylaaarlagakvvpvpldefgldlealeaalteakekgpktkaiilvpn
00445951   1/1  pppeavlealaealggllgypdppglpelreaiaallgvdpeeivvtsGatealnlalrallgpGdevlv
00507681   1/1  lralldpGdevlvpsptYpgylaaarlagakvvpvpldgfgldlealeaalkeakeatpktkliylvpnp
00460891   1/1  gYppglpelreaiaeylkrrygvgvdpdeilvtnGatealflllrallnpGdevlvptPtYpgylaaarl
00509771   1/1  alddgllgYpdpaGlpelreaiaellkrrrgvgvdpeqilvtnGatealalllralldpgdevlvpdptY
00513231   1/1  lllralldpGdevlvpsptYpgylaalrlagakvvpvpldelltggllseggflldlealeaaitpktkl
00416741   1/1  alrallgpGdevlvpsptypgylaaarlaGaevvfvpldedngfgldlealeaaitpktkavilenpnNP
00502611   1/1  ealaelgpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlelalrallgpGdevlv
00469651   1/1  lalrallgpGdevlvpsptypayaaaarlaGakvvfvpldeeggflldlealeaaitp.ktkaill.pnp
00445231   1/1  peeilvtnGatealalllral.gdevlvp.PtYplyaaaarlagaevvevpldngflldle..itpktkl
00451711   1/1  gppeglpelreaiaellarygvgvdpeevvvtnGgtealalalrllallnpgdevlvpdptypgylaaar
00462551   1/1  lpelreaiaeylkrrygvgvdpdnilvtnGasealflllralldpgdevlvpsPtYpgylaaarlagakv
00456391   1/1  ealalllrallnpgdevlipdptypnylaaaklagakvvpvpldeengfgldlealeaaleeatektkll
00497541   1/1  epdlppppavlealaealdngllgyppsqglpelrealaellaellgadldpetevlltsggtealelal
00452311   1/1  slalralkrflkgklnpgdevlvpdptypnylaiaelagaenvvevplddendfgldldallaalekatp
00533351   1/1  ddgagllgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealelalralrklgpgdevivp
00428061   1/1  pppaGlpelreaiaelllrrygvgldpervaivvtnGgtealalalrllallnpgdevlvpdptypnyla
00350731   1/1  slaaeflkrflrallnpgdevlvpdptypnylaiarlagaenvvevplddentfgldldallaalesate
00450681   1/1  llaarflallnpgdevlvpdptypnylaiaklagaevvpvplddengfgldleallaalteapektklll
00405261   1/1  allalldnltnlllkpgdevvvpdptYpgylrlakllgakvvfvdldlealekaitpktklvflesPnNP
00461651   1/1  laealasghlygygpgpgveelrealaellgae..evlltsggtealelallallkpGdevlvpdptyps
00412601   1/1  llg..aeevlltsggtaaif.allallgpGdevlvpaplygsylalarlalkrlGaevvfvdldledlea
00507541   1/1  ryhrargelgpgdevlvpdpaHgsnlaaarllGae......vvevpvdedgridlealeaaidertaavv
00501571   1/1  ldrlgngssygptpgveelrealaellgadpaevlftnggteAlelalkaarllgpgdevlvpepayHgs
00494861   1/1  dpgdevlvsepahpsvleagaaellGakvvpvpdedgkldledleaaitedtahgllpklvvltnpnnpt
00448071   1/1  lkpgdevlvsapghpsvllaeaaerlGaevvvvpvdedglldlealeaaleehrtklvilehvnnptGvv
00489521   1/1  gqgepdvppaveealallgagatgygysrgtgplrealeerlaellga..eevlltsggteAlelallal
00367801   1/1  kpGdevlvpeplygstlellralakllGaevvfvdlddledleaaitpktklvllespsnptgtvldlee
00487471   1/1  llkpGDevivpsptygatleairll.akpvfvdvdedggndlealeaaitpktkaiilehpsnptGtvld
00380341   1/1  gpGDevlvpdplygstielfglalrlaGaevvfvdlddlealeaaitprtklvvlespsnptgtvad...
00511951   1/1  kpGDevlvpapaygsylallrlllkrfGaevvfvdlddlealeaaitpktklvvlespsnptgtvld...
00474411   1/1  ltgggtealeaallallgpgdkvlvpapgyfsvrlaelaerlgaevvvvpvdpgglvdpealetpdtklv
00507531   1/1  ltpgdevlvpdgahpsnlaalqtlaallGaevvvvplddlealeaaldedtaavllehpnptGvvld...
00480741   1/1  llaellgadedaeevlltsggtealeaallallkpgdevlvsdpahgstlyakaakllGaevvfvplded
00401341   1/1  kpgdevlvpslahgs.tlaaarlagakrlgievvfvdvdpetglidlddleaairprtklivlehsnptG
00364061   1/1  kpgdevlvddlahgstlagarlanasglGaevvfvpvdedglidledleaalkektklivlessnptGvv
00421441   1/1  ayglkpgdevlvsslehgsvlraaellerlGae......vvlvpvdpdgrldlealeaaidpntklvvle
00417041   1/1  lgpgdevivpspthvatlaailllGakpvfvdvdetgnidlealeaaieehtpktkaii..vvnptGvva
00485711   1/1  ylydvdGnrylDflagigvvnlGhnhpevveaiadeeqldkllhvallsngaphepaeelaeklaelape
00465471   1/1  iiftsggtealnlallalrrallkpgdeilvsspehpsvlkaaellerlgae......vvevpvdedgrl
00517571   1/1  kpgdeilvsrglyhgslihglklsgakvvfvddledlekaikektklvvl.psnptgrilsledlkeiae
00473401   1/1  alltsggtaailaalallkpGdevivsdpaygstlallrllleraGaevvfvdlddlealeaaitprtkl
00520701   1/1  algpgdevlvdelahhsildgarllgaevvvvphndldaleaalteagpprtklvvlesvnnptGtiap.
00408971   1/1  taAlllallalglgpGDeVivpaltfvstanavllaGakpvfvdvdpdtfnidpealeaaitprtkaiv.
00523021   1/1  eiaaafealesgyiysriggptveeleealaellga..eealltssgtaAlllallallkpGDevivpap
00462061   1/1  fagyrggygysrlrnptaealeralaaleg..aeevvltssgtaAialallallkpGDevlvsdplyggt
00460071   1/1  gpgdivivdeltHgstldglrlsgakvvfvphndlealeaalaeatprtkavvvesvfsptGdiap...l
00440831   1/1  yggnpgvdeLeerlaell..gaehavftnsGteAnllalkallkpgdevivpdlayggtteagllaga.k
00470951   1/1  dpgeevvftgggtealeaallgllkpgdkvlvssnghfsvllaeiaerlGaevvvvpvdegglvdleale
00459731   1/1  iasnnylppavleallealtnkygegypgsrlylgteavgplveeleerlaelfgaeadelgvavftssG
00490701   1/1  aallsplkpgdevlvsalehgsvlaalallaerlGaevvfv.dv....idlealeaaltpdtklvllthv
00521641   1/1  lkpgdkvlvssnghfsvlaaeaaerlGaevvvvpvdpgglvdlealeaaleepdtklvalthvetstGvl
00500761   1/1  eAnllallaarepgdevivsataHisvleagailglggakvvlvpvdedgkldleaLeaairedtahvhg
00423831   1/1  llaarnralpkrkaaglgipgpeilvs.paHysvlkaarllgievrlvpvdendgrmdlealeaaident
00460561   1/1  aaahlkpgdevlvsalehpsnlaalrllaerlGaevvvvpvdpdglldlealeaaldprtklvalthvsn
00495241   1/1  ppevleamleallellgnphssgyslsrganplveelrerlakllgaddpeeivftsggtealnlallal
00465841   1/1  lgpgdeilvsalehpsvleaarllaerlgaevvfvpldeevdglldlealeaaltpktklvvlehvsnet
00453921   1/1  ayylakgrlgtggdkilvfeggYHGrtlgalsltgspsylggfgplgagvvvvpypdlealeaaiepdtv
00460871   1/1  ----------------------------------------liilenpvnpaGgsvysladlkaireiAdk
00467471   1/1  hpavleaaiealdkygvgspgsrllyg.ttplhdeleerlaellga..eaalvfnsGteAnlaalrallg
00476701   1/1  nllallaardralprrkaeglaalgleglpglvilvsdpaHysvekaarllGlg......vrlvpvdeng
00428091   1/1  ayalakgtprdkilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvpapylyrteelgyndldal
00358461   1/1  gpGDevlvdrpsHksilnggarlaGakpvylptdrngfggiggirfkhldpealeealtelkpeglrplp
00461541   1/1  gteyvdpleeeleerlaelfgaehallfanvqpssGtaAnlaallallkpgdevltpslehgGhlthgst
00459091   1/1  iaellgakya..lavssGtaAlllallalglgpgdeVivpsptfvatanaillagakpvfvdvdpdtfni
00352461   1/1  ----------------------------------------avileptqnptGgqvpsleylkelreiakk
00527311   1/1  elEealaallga..kyavavssGtaAlllallallglgpdgkeVivpsltfvatanaillagakpvfvdv


                         +         -         -         -         -         *         -:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPREAE
00389521   1/1  pdptYpgylaaarlatgaevvpvpldeeggflldlealeealtealkegpktkalllpnpnNPtGtvlsl
00503901   1/1  kaiilpnpnNPtGavlsreelealaelarkhglllieDeayaelvydgkpfpslasldgeygrvivlgSf
00528621   1/1  llnpGDevlvpdptYpgylaaarlagakvvpvpldedgflldlealeaaitpktklillpnpnNPtGtvl
00479561   1/1  pldndfgldldaleaaiktpktkllllcnpnNPtGavlsreelealaelarehgillivDeayadlvydg
00354011   1/1  vll.pnpnNPtGtvlsreeleellelarehglllivDeayaelvfdgapfpslaslllelglrllpdayg
00375691   1/1  eleelaela.khgalvivDeayaelvygg..pllslldllgrvivlgslsKtlglaGlRvGylvappeli
00393411   1/1  tGtvldleelealaelarehgllvivDeayaelaydgrpapsllsldpdalgrdivvfSfsKtlglpglr
00355891   1/1  tGtvldleelealaelarehglllivDeayaglvydgklpgslaeldgvdivlgsfsKalglpGlrlGyl
00460241   1/1  ptYpgylaaaelaGaevvpvpldeeggflldldaleaaitp.ktklivl.pnpnNPtGtvlsreeleela
00506961   1/1  pnNPtGavlsleeleallelarkhdllvieDeayaelvydgkpfpslasldepdrvivlgSfsKtllpGl
00445951   1/1  psptypaylaalrllGakvvfvpldleedgflldlealeaaitprtkaillvnpnNPtGavldleeleal
00507681   1/1  nNPtGavlsleeleallelarkhdllvieDeayaelvydgapfpslasldapdrvivlgsfSKtllpGlR
00460891   1/1  agakvvevpldeegglflldlealeaaitepktkllll.cnpnNPtGavlsreelealaelarkhdllvi
00509771   1/1  pgylaaaelagakvvpvpldeeggflldlealeaaltpktklvlltnPnNPtGtvlsleeleallelark
00513231   1/1  iilnnpnNPtGtvlsreelealaelakkhglllisDeayaelvydgapftsllslpdaldrvivlrSfSK
00416741   1/1  tGvvldleelealaelakkhglllivDeayaglvydg.kplsalalldalgrvivlgSfsKalglpGlrl
00502611   1/1  pdptyhgylaaarllGaevvfvpldedgldlealeaalteagadgllpktkavilepnpnnptGvvlppe
00469651   1/1  nNPtGavlsleeleelaelarehgllvieDeayaelvydgkpapslasldglldrvivlgSfsKtfglpG
00445231   1/1  lllnnPnNPtGtvlsreelealae....hgllvvsDeaYadlvydsalllleaydnlivlrsfSKafgla
00451711   1/1  lagaevvpvpldeengfgldlealeaalaeatektkllllnnpnNPtGavlsreeleelaelakehglll
00462551   1/1  vpvpldeengflflldlleleaaitpktkllllcnPnNPtGavlsreelealaelarkhgllvisDEiYa
00456391   1/1  llnnphNPtGavlsreelkelaelakehdlllisDeaYqgfvydgleedavsiaslaelgdrvivlnsfS
00497541   1/1  rallgpgdevlvpdptypgylaaarllG......aevvfvpldedgflldlealeaaltektkavilepp
00452311   1/1  ktkllllnnpnNPtGtvltpeelkelaelakehgllvivDeaYqgfayggldedapsllalleagenviv
00533351   1/1  sptypgylaaarlaGakvvfvpldedgtfgidlealeaaiteapktkaiilepnpnnPtGvvlpleelee
00428061   1/1  iarlaGaevvevpldeendfgldldaleaalteapektkllllnnpnNPtGtvlsleelkalaelakehg
00350731   1/1  ktkllllnsphNPtGtvltpeelkelaelakehgllvivDeaYqgfayggleedatsirslvelgenviv
00450681   1/1  lnnpnNPtGtvlsreelkelaelakehglllivDeaYqgfaydgldedalavrsflelldagdnvivlrS
00405261   1/1  tgtvld..........akehgilvivDeaYaepvydp.lplaydndivlrSfSKyfglaGlrlGwavvpd
00461651   1/1  ylaaarll.aevvfvpldedggldlealeaaitpktklvvlenpnnptGvvld...leeiaelakelghg
00412601   1/1  aitektklvflespnNptgtvld...leeiaelakkhllnpgalvvvDeayatpvlgd..plelgadivv
00507541   1/1  ltnpnnptGviep...leeiaelahehgallivDeayagglglgvdpgdlgaDivtlslhKtlggpkggg
00501571   1/1  tlaalrlagakvvevtfvpldpdglllpypdlealeaaitpktaavileppqnptGvvlpspeyleelae
00494861   1/1  GtvyslepleeiaalakehglllhvDgayaggalpg.lgvsvaeldgaegadvvsfslhKtlggpg.gGa
00448071   1/1  lp...leeiaelarehgallivDeaqalgal.pgdldalgvdivvfslhKalggglglGallvseeller
00489521   1/1  lkpGdevlvpdptypstlaaarll.akvvgvpvdedggldlealeaaietpktkavilespnnptGvvld
00367801   1/1  iaelahe..nhgalvivDeayaagvlld..plelgadivvgslsKylggpgdlrgGyvagseeliealrk
00487471   1/1  ...leeaiaelakkhgillivDeayalgvl..gdplelgadivvfSfsKalgGptGlrgGalvgndelie
00380341   1/1  leaiaelahkhgalvivDeayatgvlgd..plalgadivvgslsKalggpgdrlgGyvvgsdeliealrk
00511951   1/1  leaiaelahehgallivDeayaagvlgd..plelgadivvgslsKalggpgdlrgGylvgseeliealrk
00474411   1/1  llthpenptGvvld...laaiaalarehgpdallvvDaaqslgalp.ldldelgvdvvvgslqKalggpp
00507531   1/1  laalaelahaaGallivDaaqaal.gllvdpgalgadivvgslhKllgPhglggpgaGalavreellral
00480741   1/1  glidlealeaaitegpktklvvlehpsnptGvvld...leeiaelakehgallivDaayaagal.pldpl
00401341   1/1  rvad...leeiaelaheygallivDeAhaagl.lalglhglplegadivvgslhKtlgGp..rgGailvr
00364061   1/1  ad...lkeiaelaheygallivDeahaagllgldgrppgelgaDivtgslhKtlgGp..rgGyiagkdel
00421441   1/1  hpnnptGvvlp...leeiaelahehgallivDaaqaagal.pldlgelgaDivvfsahKyl.ggpglGal
00417041   1/1  d...leeiaeiakehgillieDaaqalgalygglk.aggfggadifsfslsKtlggg.ggGalltndeel
00485711   1/1  gldkvfftnsgseaveaalklarqyglglggsrlvlgtlelheeleelladtgrekilvfsggyhgntla
00465471   1/1  dlealeaaldedtklvvlthpnnptGvilp...leeiaelakehgpdallivDaaqaagvlp.ldldelg
00517571   1/1  iakeygallivDeahgaglvggpllpsplelgaDivvgSlhKtl.gGprgGyiagkkelieklrkvfpgl
00473401   1/1  vllespsnptGtvl...dleeiaelahehgalvivDeayaag..llgdplelgadivvgslsKylgghgd
00520701   1/1  ..lkeiaeladeygallivDeahaggvlgrtgrglaehlgvepdadivvgtlhKalGp..rgGalagsee
00408971   1/1  .pvnptGava...dleaiaelarehgllvivDaahalgalyggrhpgslgadivsfsasKt.ltggggGa
00523021   1/1  tygstaeairlllkrlGakpvfvdldedlealeaaitpktkaiilehpsnptGtva...dleaiaelakk
00462061   1/1  ltllrllgarggivvtfvdg.ldlealeaaitektkliflespsNptgtvld...laaiaelAhevgall
00460071   1/1  aeiaelarkhgallivDeahaggvlgrtgrgllellgl..gadivvgtlsKalGg..rgGavlgseelid
00440831   1/1  pvfvdvdedgnldlealekaitevgaektkaiileppanptGvlplspadlkaireiadkhgillivDea
00470951   1/1  ealkepktklvalthvenstGvinp...leeiaelahehgallivDavqs.lgalpidvdelgvDflvss
00459731   1/1  taAlllallallkpgdevlvpslahggstlaaarll.Gagvnfsgllfkvvfvdvddetgnidledleaa
00490701   1/1  snptGvlld...ieaiaalahehGallivDaaqaagll.pldvgelgaDfvvfsghKtlgggppglGfly
00521641   1/1  lp...leeiaelahehgallvvDavqs.lgalpidvdelgvDllvasahKglggppGlGflyvsedller
00500761   1/1  trpvlveitgntetGtvysldeleeiaelcrehglllhvDgArlgnalgalgvdlaeldgaegaD.svsf
00423831   1/1  alvvatagttptGaiddieeiaelaeeygletglgiwlhvDaAyggfllpfleklrpldfglpgvdsisv
00460561   1/1  vtGvilp...laeiaalahehgalvlvDaaqaagalpl.dlgelgaDfvvfsghKllG.ppGvGflyvrk
00495241   1/1  alaglkpGdevivsapehpstlaawrllaerlGaevvfvdvdedglidlealeaaitpkTklvalvhpsn
00465841   1/1  Gvilp...lkeiaelakehnGdlsallivDaaqavgalg.ldlaglgvDivvfslhKalggpggiGalyv
00453921   1/1  aavivepvqgegGvivpppeflkalrelcrkhgillivDEvqtgfgrtgklfafehlgvtpdivtlsKal
00460871   1/1  yglllivDaAraagalyaggvtgspyafrsigeivdeifgyadivsfslsKglg.gprgGaivtndeela
00467471   1/1  pgdivlvdelnHgstldglrlsgaevvfvphnDldaleallkelreegpkpkliivegvfsmtGdiaplk
00476701   1/1  rmdleaLeeaieedtaaglipaavvatagttptGai...dpleeiaeicrehgiwlhvDaAygggalpfp
00428091   1/1  eallaehgekiaavivepvvqgegGvivpppeflkalrelcdkhgilliaDEvqtgf-------------
00358461   1/1  ktkavvltnpnptGtvyp...leeiaelakkhglyllvDeAhgagayggpgrglaehlg-----------
00461541   1/1  fdatalalsglgaepvfydvdpetglidpdaleealrertpaiivagvsaygrladlkelreiadev...
00459091   1/1  dpedleaaitpktkaii..pvnptGnvad...ldaiaeiakkhgllvieDaayalgalyk..gkkvgsfg
00352461   1/1  hgillilDearlaenayfgfgrtgslfaleiagivpdiltladvvtfslsKgggapgGgvlatgdkelie
00527311   1/1  dpdtnidpedleaaitpktkaii..pvnllGqvad...ldeiaeiakkhglllieDaaqalgalykgkkl


                         -         -         -         +         -         -         -:280
query           RKAAAALLSRRAEVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
00389521   1/1  eelealaelarkhgillivDeayaelvfdgppfpslasldgallllpldlgrvivlgSfSKtlglpGlRl
00503901   1/1  sKtlglpGlRlGyvvappeliealrklrsaltlgvsplaqaaaaaaledgelrlerleehleelrarlre
00528621   1/1  sleelealaelarkhglllivDeayaelvfdgepppslldalgrvivlgsfSKtlglpGlRlGylvappe
00479561   1/1  asfvslaslldnvivlrSlsKafglaGlRlGylvappeelieallklrs.plgvstlaqaaaaaaledg.
00354011   1/1  rvivlgsfsKtlglpGlRlGylvappeliealrklksa.tlsvstlaqaaaaaaledgelleehleelre
00375691   1/1  ealrklrsp.lgvstlaqaaaaaaledgllehleelrerlaerrdllleaLeelglvsvvgpsgglflwv
00393411   1/1  vGylvadpeliealrklrsgggstpsplaqaalaaaledgeehleelrerlrerrdllaeaLaelpgvev
00355891   1/1  vadpeliealrklrsggtlgpsplaqaaaaaaledlelleehleelrerlrerrdrlaealaelglevvg
00460241   1/1  elarehgillivDeayaelvydgepkdalppslasldglgrvivlgsfSKtfglpGlRlGylvapeelie
00506961   1/1  RlGylvappeliealrklrsgltlgvstlaqaaaaaaledggyeehleelrarlrerrdlllealkellp
00445951   1/1  aelarehgllvieDeayaelvydgpfpsladldagrvivlfSfsKtlglpGlrvGylvappeliealrkl
00507681   1/1  lGylvappeliealrklrslltlgvsslaqaaaaaaledglydehleelrallrerrdllleaLeellpp
00460891   1/1  sDeaYadlvfdgapfpslasllpdlydrvivlrslSKtfglpGlRlGylvapnpelieallklkspltlg
00509771   1/1  hgllvisDeayaelvydg.pfpslasldgydrvivlgsfSKtfglpGlRlGylvavgppelieallklll
00513231   1/1  tfglpGlRvGylvappeliealrklksalglgvstlaqaaaaaaledgllglegdeehleelrerlrerr
00416741   1/1  Gylvadpeliealrklrsggtfgpsplaqaaaaaaled...eleelrerlrerrdllaeaLeelglevvg
00502611   1/1  elealaelarehgallivDeayagfvytgkpagslaaldelgvdivlgslsKtlggglrlGalvgdeeli
00469651   1/1  lRlGylvappeliealrklrspgnssvstlaqaaaaaaledgeflehleelrerlrerrdllleaLaelg
00445231   1/1  GlRlGylianpeliealrklrsp..lnvstlaqaaaaaals.dldyleelrerlrerrdllveaLaelgl
00451711   1/1  ivDeayaglvyggeedapsllaladalprvivlgSfsKtfglpGlRvGylvappeliealakvksqllll
00462551   1/1  dlvfdgepppsllldaydrvivlrslSKtfglaGlRlGylvapnelirallklrspltlgvsslaqaaaa
00456391   1/1  KtfglpGlRvGylvapnkdaelakelisalkklkrpltsnpptlaqaaaaaalsdpelreewleeleelr
00497541   1/1  nnptGvvlpleeleelaelarehgillivDeayagfvytgklpvslaellgvagadivvgSfsKalglpG
00452311   1/1  lrSfSKafglaGlRvGylvappelieallkvlsqlklliralpsnpptlgqaaaaaalsdpelralwlee
00533351   1/1  laelakkhgillivDeayagfaydlggkgpsllelldlgpdvivlgSfsKalglpGlrvGalvgpdeell
00428061   1/1  illvvDeaYagfafggeedapsilelagagpnvivlgSfsKtfglaGlRvGylvapaeliealakvlsql
00350731   1/1  lnSfSKnfglaGlRvGylvappelieallrvksqlkllirslysnpptlgqaaaaaaLsdpelraewlee
00450681   1/1  fSKtfglaGlRvGylvappevvladaellaalisallklkraltsnpsslaqaaaaaalsdgellaewle
00405261   1/1  eelidklrklklpltigvsslaqlaalaalkdpldaylllrgesletlelrrerlrerrellaeaLeelg
00461651   1/1  allivDeayalgvl..gdplelgadivvgslsKtlngpgGlrgGalvgndeliealrkvrrglggtlspl
00412601   1/1  hSlsKalggagdlriGyvvgndelidalrklrgp.ltgstlspaaaaaalrgletl..elrrerlaenaa
00507541   1/1  GprlGallvrdelaealplrlggggergfvltldreqairrglagtgnalaiaaaaaalrllgeeglkel
00501571   1/1  larehgallivDeayagfgrtglpfapealgvdivigslsKalggglglGavlgsdeladalrplrrglt
00494861   1/1  llvrdelaealpllrggggetgrrsgllaaaalaalglegleelaarlreladylaegLaelglelvgpp
00448071   1/1  lrpllsggtslyldlllllkyeqerrfragtpnplaaaallaalellleeglealrarlaeladylaegL
00489521   1/1  ...leeiaelakehgallivDeayaggal..gdplelgadivvgslsKalggpaGlrgGalvgndeliea
00367801   1/1  lrpggglggtlspaaaaallrgletlelrreraqenadylaelLeelglvvlvyypglpsgafyllaklp
00487471   1/1  allkllrggggggtlsplaaaallaale.tl.eerlerlrenadllaeaLeelpgvtlvlypglpshpgh
00380341   1/1  lrlgggfggtlspaaaaallrgletl..elrrarlrenadllaeaLaelpgvvlvlypglpshpghelak
00511951   1/1  lllggglggtlspaaaaaalagle..tleerrarlrenadrlaeaLaelggvalvgypglpshpghelak
00474411   1/1  glGflavspellerleplsgylglallldlqekrfepgtppvlaiaallaalellleegle.rrarlael
00507531   1/1  pgrlvgvtgdadgkralrlalqtreqhirrekgtsnictpnglaaaaalaaldllgleglearaeralal
00480741   1/1  elgaDivvfslhKalggppgvGallvrkelieklrpllpgglldlvlalkylgavlgfftgtpnilgiaa
00401341   1/1  delaeklrsllfgggfggtlspllaaallaalelleeglkerrerlvenaarlaeaLeelgfvvvvgppd
00364061   1/1  qelieklrrlkaplgfgtalspliaaaalaalelleegleelaerlvenaaylaegLkelgfvvvvgppg
00421441   1/1  lvrdellerlrpllhggglekrfeagtpnplaiaallaalellgeglealraralelaeylregleelpg
00417041   1/1  aerlrplrlggisidlkylvqelgfnsgtspiaaaaglaalegleeilerrreladylaeaLkelpglel
00485711   1/1  llaltgpgdevlvpdplypgylhaallagarvvfvpldvdedghldlealeaaleeldaggdrtaavile
00465471   1/1  vDfvvfsghKal.gppgiGalyvrkelllrpllvgggqerrfeagtpnvlaiaalaaalellgegleair
00517571   1/1  ggspsplvaaallaalktlllrgfkryleealklakalaeylyeglkklpglegfkvvspgggnilsfil
00473401   1/1  lraGylagreelidklrgllvglgggt.lspaaaaallaale..tlelrreralenadylaelLaelpgv
00520701   1/1  lidalrplarggtfsgtlnplaaaaalaalellgeegleelrerlralaaylaegLael.glpvvgglga
00408971   1/1  vvtndeelaerlrklrnhglsrgllllvlaalllryevlllgynyrlspiqaaallaaletlderlerrr
00523021   1/1  hgilvivDeaqatggllydglelg..adivvfSfsKylggtGdrlGglvvtndkelierlrplrsggtsi
00462061   1/1  vvDntyaapll..ldpl-----------------------------------------------------
00460071   1/1  alrplarggtfsgslnplaaaaalaalelleeegleelrerlaelaarlregLael.glevvpglglivp
00440831   1/1  haaglaytgklfgseyagvaigelvpdlfggadivsfslsKtlggp.rgGailtndeeladklrklrfpg
00470951   1/1  shKglggppGlGflyvsekalerlknrklpplsgggdlllllkfmladqerrfeagTppvaliaalaaal
00459731   1/1  itepktkaiiv.vasnp.Gviad...leeiaeiakkhgallivDaAhalgavgldvlpgplggaDivsfs
00490701   1/1  vreellerlppllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalellglegleaiaarh
00521641   1/1  leplllgggslyldlkllldyllayqergfeagTppvaliyalgaalellleegleairarhreladalr
00500761   1/1  slhKglgapg.ggallgrdeliekarllrkrlggllrqagllaaaalaalgeegleellaranalarrla
00423831   1/1  sghKyglaplgcGvvlvrdkellrealsvnadylggdlgsftlegsrpgaralalwaallslgregyeel
00460561   1/1  ellerlppllvgggqvaavsldlalqlrllerrfeagtpniagiaallaalellgeegleairarlrala
00495241   1/1  ptGvvlp...leeiaelahehgalvivDaaqaagalpid.ldelgaDfvvfsahKwl.gppGiGalyvrk
00465841   1/1  rkelldrlrpllhgggslilvvrfdsltlqelglrfefgtppvaaaaalgaalelleeeglleairerlr
00453921   1/1  gggglplgavlgseeiadalgpllhggtfggnplacaaalaalellee..eellerlrelgdylleglee
00460871   1/1  kkarklrfpgegfllgggprqhgiaaaaallala..eleeylerrhenarylaeaLkel......gipvv
00467471   1/1  elreladky...gallivDeahaggvlgatGrgllehlgvlpdadivtgtlsKalggg.rgGailgskel
00476701   1/1  e.yrllldgiegaDsitfslhKwlgvplgcgallvrdkellrralsvdadylgslddggdgvrdlrdftl
00428091   1/1  ----------------------------------------------------------------------
00358461   1/1  ----------------------------------------------------------------------
00461541   1/1  gallivDaAhaaGlvaagvlpspfggadivtftthKtlrGp..rgGailtrdelldellrllrgfgfdla
00459091   1/1  divvfSfsktKnltg.gegGaivtndkelaeklrllrnhgtsksyhglkyvhlllgynyrlseiqAalgl
00352461   1/1  klrrlrkvlgegffthgglagagplalaaglaelel..edllarvienanylaeaLeelgvpvvtpvggh
00527311   1/1  gsfgdivvfSfhatKnltg.gegGavvtndkelaeklrllrnhgisrdglrkyvhlllgynyrlseiqAa


                         -         *         -         -         -         -         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILAQGWCRA-----------------------------------
00389521   1/1  Gylvakppeliealrklrsp..lsvsslaqaa--------------------------------------
00503901   1/1  rrdllaealeelglkvvppeggfflwvdlpel--------------------------------------
00528621   1/1  liealrklkspltlgvsslaqaaaaaaled----------------------------------------
00479561   1/1  .eyleelrarlrerrdllaealeelglkvl----------------------------------------
00354011   1/1  rlrerrdllleaLeelglevlppegglflwvd--------------------------------------
00375691   1/1  dlp.daeelaealleegvavrpgsafgvgpgy--------------------------------------
00393411   1/1  vgppggfflwvdlpglgldaeelaeaLleeag--------------------------------------
00355891   1/1  pgg...glflwvdlpdlgldaeelaealleag--------------------------------------
00460241   1/1  alrklkgggllraltlsvstlaqaaaaaaled--------------------------------------
00506961   1/1  pglevvppeggfflwldlpegldaeelaeall--------------------------------------
00445951   1/1  rslgglgvstlaqaaaaaaledglflehle----------------------------------------
00507681   1/1  glkvlppeggfflwldlpdgldaeelaealle--------------------------------------
00460891   1/1  lvstlaqaaaaaaledgeeyleelrarlrerr--------------------------------------
00509771   1/1  lkslltlgvstlaqaaaaaaledgeehleelrarl-----------------------------------
00513231   1/1  dllaeaLeelglkvlppeggfylwvdlpelll--------------------------------------
00416741   1/1  psggfflwldlp....gldaeelaealleagv--------------------------------------
00502611   1/1  ealrklrhggtftgnplaqaaalaaledlaleehle----------------------------------
00469651   1/1  levlppeggfflwvdlpelgldaeelaerlle--------------------------------------
00445231   1/1  evlppeggfylfldlsldaeelaerlle------------------------------------------
00451711   1/1  irgltlnpptlaqaaaaaaledgalr--------------------------------------------
00462551   1/1  aallaygggeehleelrarlrerrdlllea----------------------------------------
00456391   1/1  erlkerrdllveaLkklptpggldvi--------------------------------------------
00497541   1/1  lrlGalvgdeelidalrklrrggtftlspla---------------------------------------
00452311   1/1  leemrerlaerrdllveaLkelggpg--------------------------------------------
00533351   1/1  llalliealrklrrpgtgspsplaqaaaa-----------------------------------------
00428061   1/1  klliraltsnppalaqa-----------------------------------------------------
00350731   1/1  leemrarlkerrdllveaLeklggpgdld-----------------------------------------
00450681   1/1  eleemrerlkerrdllveaLrelglp--------------------------------------------
00405261   1/1  gvsypglpshpyhelakkvlpggafyvllkl---------------------------------------
00461651   1/1  aaaallaalegleerrerlrenadrlaeaLaelpgv----------------------------------
00412601   1/1  llaeaLeelgpgvevvlypglppegahyla----------------------------------------
00507541   1/1  aerlveladylaegLkelpgvevvgp--------------------------------------------
00501571   1/1  fggnplaaaaalaalellee..eelrerlrela-------------------------------------
00494861   1/1  g...anivfvdlp.gvdaeelaaalleagi----------------------------------------
00448071   1/1  eelglelvgppgrrsgllvsfdlpdgvdaeel--------------------------------------
00489521   1/1  lrklrsggggtlsplaaaallaale...------------------------------------------
00367801   1/1  akgrggllsfelkg...daeavakll--------------------------------------------
00487471   1/1  elakklvpggggll--------------------------------------------------------
00380341   1/1  rqlpggggivsfelkgdgedaeafadaL------------------------------------------
00511951   1/1  kvlpgrggfvsfdlpgggedaeafadaLkeag--------------------------------------
00474411   1/1  adalragleal...glell.peg.......----------------------------------------
00507531   1/1  anylaaaLeelpgvrvlgpggaghev--------------------------------------------
00480741   1/1  laaalellgeeggleeilerlreladylyeglkelg----------------------------------
00401341   1/1  ...ghlvsvdlpglgidaldlakaL---------------------------------------------
00364061   1/1  ...ghivlvdlpgdgidakalakaLeeagi----------------------------------------
00421441   1/1  lelvgppgrrlggivsfelp.gvdae--------------------------------------------
00417041   1/1  vgppglsaphlfpvllplpeltelllplggll--------------------------------------
00485711   1/1  p.vqnptGvvlppeeylkelrelarkhgillivDe-----------------------------------
00465471   1/1  arlleladyllegLkelpglellgppg.rrgn--------------------------------------
00517571   1/1  pvdlgdgidalelaklllelygiavspgsh----------------------------------------
00473401   1/1  ylvgypglpshpghelakkvlpgrgg--------------------------------------------
00520701   1/1  ivlvdlgdgvdakalaaallleaGi---------------------------------------------
00408971   1/1  enadrlaelLaelpgvelvkppglsshafy----------------------------------------
00523021   1/1  syvglvtldllprrfeagtpnvagli--------------------------------------------
00462061   1/1  ----------------------------------------------------------------------
00460071   1/1  velgdgldalalaeallerGilvrpisypavp--------------------------------------
00440831   1/1  egfplgggyrgspiaaaaallal..ellee----------------------------------------
00470951   1/1  ellleeGleairarhreladalregleal.gl--------------------------------------
00459731   1/1  lhKtlggp..p-----------------------------------------------------------
00490701   1/1  leladylaegLaalpavpglellgpp--------------------------------------------
00521641   1/1  egleal.glellgpdpelrspgvvsfrlpe----------------------------------------
00500761   1/1  egLaalpglelvgppetnivffrlpg--------------------------------------------
00423831   1/1  verilelarylaelLeklggfellsdgepalp--------------------------------------
00460561   1/1  dylaegLaalpglellgperrggivsfrlp----------------------------------------
00495241   1/1  elldkllpllrggg--------------------------------------------------------
00465841   1/1  eladylregLeelpglelvgppggrgpi------------------------------------------
00453921   1/1  ll.lplvgdvrglGlmlgielvsddgllalal--------------------------------------
00460871   1/1  gptgghlvfvdlrkllphipgdtglsgallae--------------------------------------
00467471   1/1  idklrslarpgifstslnplaaaaalaale----------------------------------------
00476701   1/1  egsrrfralklwaalralgreglrelierliela------------------------------------
00428091   1/1  ----------------------------------------------------------------------
00358461   1/1  ----------------------------------------------------------------------
00461541   1/1  kkinsavfpglqggplnhviaalaa---------------------------------------------
00459091   1/1  aq..leklderlerrrena---------------------------------------------------
00352461   1/1  gvfldlelvldpipgdqfpa--------------------------------------------------
00527311   1/1  ----------------------------------------------------------------------