[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL65085.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
  59::331  5.7e-38 25.7% 0043105 00431051 1/1   al SAM enzymes                          
  91::345  4.7e-31 23.8% 0049709 00497091 1/1   al SAM enzymes                          
  71::297  5.2e-05 17.3% 0048596 00485961 1/1   al SAM enzymes                          
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRAVYSWPAPVYKPGEYLLKLPNVRESPYQTREEGGSVVCTLCHRRCRLPPGKIGACGMRFNLGGRLYT
00431051   1/1  ----------------------------------------------------------gegltleealal
00497091   1/1  ----------------------------------------------------------------------
00485961   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AAYGLLTAAESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
00431051   1/1  l..rlpllellceaakcprrdrfgrrvtltllisvktngCplrCkyCavsagsgtglkkprllspeeile
00497091   1/1  --------------------aplfdlfgrppltlllevtnrCNlrCsyCyapagpglelrplvrerelsl
00485961   1/1  vvtplrlglidlydlpgprytsyptapelselfgpkvyklplaeifsdplslyihipgCpnrCtyC.dfp


                         +         -         -         -         -         *         -:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
00431051   1/1  eakaaaelGvkrvvltggepllrpdgaeylleliraikelgleitt.tnglldeelleelkeaGldrvnl
00497091   1/1  eeilrlidelaelgvkevvltGGEPllrpd.leelieylkelggllrvsltTNGtlltelaeelkeagld
00485961   1/1  sivtkrgklrsryleallkeiellaallggrgvkeiylgGgtptllgpdqleellealrelfpldgdvei


                         -         -         -         +         -         -         -:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKLFNPP
00431051   1/1  sletdpelykkirpghtyedvlealerareaGikvksglilglgetdeellellellrelgkrvdsvtii
00497091   1/1  rvnisldgldpethdkirgvkgsfekvleaiellreagipvkintvvlpgenddeleelldllkelgvdl
00485961   1/1  tletrpdtl.ddelldllkeagvnrlslgvQsfddevlkainRghtveevleavelareagfdsinldlI


                         -         *         -         -         -         -         +:350
query           TPPELLEELWRRARRELDYVYVGNVPGHPGQHTYCPRCGYAVIKRAGDRAVKIELAQGRCPKCGWEIPIR
00431051   1/1  ellpvpgtpladlpplsleellrliavarlllpeaiirlsagrvtlfeelr-------------------
00497091   1/1  vfifplvpvggtplarlpllspeeileellaalillpksrlrlglparrgkipllllllgfiapl-----
00485961   1/1  yGlPgetledfletlel-----------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GKPGKYGRLYRSFI--------------------------------------------------------
00431051   1/1  ----------------------------------------------------------------------
00497091   1/1  ----------------------------------------------------------------------
00485961   1/1  ----------------------------------------------------------------------