[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ20846.1


[Show Plain Result]

## Summary of Sequence Search
   1::304
 107::297  PF07478 0.0% 31.9371727748691  D-ala D-ala ligase C-terminus 
   3::45   PF01820 0.0% 37.2093023255814  D-ala D-ala ligase N-terminus 
  50::86   PF01820 0.0% 51.3513513513514  D-ala D-ala ligase N-terminus 
  94::277  PF08443 0.0% 27.2189349112426  RimK-like ATP-grasp domain 
  96::190  PF01071 0.0% 22.8260869565217  Phosphoribosylglycinamide synthetase, ATP-grasp (A) 
   1::304


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
PF07478         ----------------------------------------------------------------------
PF01820         --lkvavlfGGrSsEheVSlkSakavlkaLdkekyevvpigitke----eakekvdvvfpvlHGknGEDG
PF01820         --lkvavlfGGrSsEheVSlkSakavlkaLdkekyevvpigitke----eakekvdvvfpvlHGknGEDG
PF08443         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYIKFNHKKNKLNIIKLIEKNLKFPVVV
PF07478         ------------------------------------aglpvapfivlekeeakkeklekvveklgypvfv
PF01820         tiqgllellgipyvGs------------------------------------------------------
PF01820         tiqgllellgipyvGs------------------------------------------------------
PF08443         -----------------------ardKlkslklLakkkikvpkt.alarseedae..kliekikqfPvvv
PF01071         -------------------------sKsfakdllkkagiptaeyeaftdpeeakeyieeataka...lVv


                         +         -         -         -         -         *         -:210
query           KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
PF07478         KpareGSSvGiskveseeeleeaieeafqydekvlveeaiegreievavlgneklevsevgeivlkkgfy
PF01820         ----------------------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF08443         KsvfgsqGikvvlaedkqsleqlleafkqlkeailvQefIeeaenrdiRvlVvgdevvaalervske..G
PF01071         KadglaagKgvivakseeealkavkeilekkkfGeagekvviEelleGeE--------------------


                         -         -         -         +         -         -         -:280
query           YNSSAKTKHLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPE
PF07478         dyeekyelidssaeievpakleeeveekikelakkaykalglkGlaRvDfflteegeivlnEvNtlPGfT
PF01820         ----------------------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF08443         dfrsNlarGgvae...klqlseeeeela.ikaaeameldvlgvD.ilesk.....rgllvlEvNssv---
PF01071         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IAKHKGISFIKLIEWILKDASINR----------------------------------------------
PF07478         siSlypklaaaaGlsfe-----------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF01820         ----------------------------------------------------------------------
PF08443         ----------------------------------------------------------------------
PF01071         ----------------------------------------------------------------------