[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ20908.1


[Show Plain Result]

## Summary of Sequence Search
   1::611
 292::367  PF08459 0.0% 19.7368421052632  UvrC Helix-hairpin-helix N-terminal 
 385::543  PF08459 0.0% 44.7368421052632  UvrC Helix-hairpin-helix N-terminal 
  22::97   PF01541 0.0% 36.8421052631579  GIY-YIG catalytic domain 
 211::240  PF02151 0.0% 50  UvrB/uvrC motif 
   1::611


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSSELGKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
PF08459         ----------------------------------------------------------------------
PF08459         ----------------------------------------------------------------------
PF01541         ---------------------wgvYiivnkknkvlYiGstnnlerRlkeHnagkesketkqkkygkdkfe
PF02151         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EITTTANESEALLLEANLIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASA
PF08459         ----------------------------------------------------------------------
PF08459         ----------------------------------------------------------------------
PF01541         ltiveeirtkqealelEkelikkynpn-------------------------------------------
PF02151         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GTANWTIKMLQKIFQIRVCDDSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDI
PF08459         ----------------------------------------------------------------------
PF08459         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QKNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQ
PF08459         ----------------------------------------------------------------------
PF08459         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF02151         lkeLeeemeeAaeeedFEkAAklRDqinal----------------------------------------


                         -         *         -         -         -         -         +:350
query           NWGNQAYFPKHDPDQSLSEIMSSFLMQFYENKNVPKLIIINTEIEDKKLIEETLSKKENSAISINVAKKG
PF08459         -----------dDyasmrevltrrfkrlleeeaklPdLiliDGGkgqlnaakevleelgleipvvglaKk
PF08459         -----------dDyasmrevltrrfkrlleeeaklPdLiliDGGkgqlnaakevleelgleipvvglaKk
PF01541         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TKAKVIAMAEKNAKESLNRKIYETNNNKNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNE
PF08459         eeektkklllpgekeel-----------------kelleleelpkriecfDiShiqgedtvasmvvfedg
PF08459         eeektkklllpgekeel-----------------kelleleelpkriecfDiShiqgedtvasmvvfedg
PF01541         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFG
PF08459         kpkkseYRkykikeiteg.dDyasmrevltrrfkrlleeea...klPdLiliDGGkgqlnaakevleelg
PF08459         kpkkseYRkykikeiteg.dDyasmrevltrrfkrlleeea...klPdLiliDGGkgqlnaakevleelg
PF01541         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLD
PF08459         le.ipvvglaKkeeektkk..lllpgekeelklkknseallllqrirdeahrf-----------------
PF08459         le.ipvvglaKkeeektkk..lllpgekeelklkknseallllqrirdeahrf-----------------
PF01541         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE-------------------
PF08459         ----------------------------------------------------------------------
PF08459         ----------------------------------------------------------------------
PF01541         ----------------------------------------------------------------------
PF02151         ----------------------------------------------------------------------