[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ20910.1


[Show Plain Result]

## Summary of Sequence Search
   1::293
  50::272  PF01063 0.0% 29.1666666666667  Aminotransferase class IV 
   1::293


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKI
PF01063         -------------------------------------------------lfleeHlqRLaksakal.iel


                         -         -         *         -         -         -         -:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
PF01063         pldseelksilqeliqklglqsgrlrivisrgegdlggegatkslvssfekllalknsaperlsladdlr


                         +         -         -         -         -         *         -:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
PF01063         lssqpvsspv....plaglKtlnrldnvlaalraarragvddvllldedgnitEgsisNvfil.kggely


                         -         -         -         +         -         -         -:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLN
PF01063         TPplssgiLpGitrqvlielakelgi.vrersltlkdleqadeafltnslrgilpvtsidge--------


                         -         *         -         -         -         -         +:350
query           ESYQALVRKRKAA---------------------------------------------------------
PF01063         ----------------------------------------------------------------------