[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ20943.1


[Show Plain Result]

## Summary of Sequence Search
   1::165
   7::137  PF00430 0.0% 29.2307692307692  ATP synthase B/B' CF(0) 
   1::165


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDNAQNKLDTAQT
PF00430         ------etnlinflilvglliyl.gykpLgkiLdeRkekIankikeaeerlkeaaellaeaeqqleqArk


                         -         -         *         -         -         -         -:140
query           VSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEIKDVSIKIAVDSVKKIINTSV
PF00430         easeiienakkeaqklkeeilaeaekdierllesakaeiekekeqalaelrkqvaaLalqiaekllk---


                         +         -         -         -         -         *         -:210
query           DKSKLDGLFEKNLEETKIALKKISS---------------------------------------------
PF00430         ----------------------------------------------------------------------