[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ20988.1


[Show Plain Result]

## Summary of Sequence Search
   1::215
  28::107  PF02588 0.0% 29.1139240506329  Uncharacterized BCR, YitT family COG1284 
 124::199  PF02588 0.0% 30.6666666666667  Uncharacterized BCR, YitT family COG1284 
   1::215


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFLKIKDIPKVYWSSEKPLNLKPKISTFFFLCLGLVLFGLGEGLLIVSFAGASPWSILAQGIALNVDLSI
PF02588         ---------------------------llfaiigglllglgisiflkagastgGtdgiayylskkkgisi
PF02588         ---------------------------llfaiigglllglgisiflkagastgGtdgiayylskkkgisi


                         -         -         *         -         -         -         -:140
query           GIITVLISIGVLFLWLPLKQKPGIGTILNAIIIGLMIDVCIKFIPTPENYLNQLILATIAVLTVGLGGGI
PF02588         gsillliniilliislllf.gfprlfatllaiivvgi----------------llfaiigglllglgisi
PF02588         gsillliniilliislllf.gfprlfatllaiivvgi----------------llfaiigglllglgisi


                         +         -         -         -         -         *         -:210
query           YLVANLGAGPRDGLMVGLQKKTNLPIATVRAFLEITVMSIGWYLGGTVGIGTLLFAFGIGPSVALGLYLV
PF02588         flkagastgGtdgiayylskkkgisigsillliniilliislllf.gfprlfatllaii-----------
PF02588         flkagastgGtdgiayylskkkgisigsillliniilliislllf.gfprlfatllaii-----------


                         -         -         -         +         -         -         -:280
query           GKTFN-----------------------------------------------------------------
PF02588         ----------------------------------------------------------------------
PF02588         ----------------------------------------------------------------------