[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21022.1


[Show Plain Result]

## Summary of Sequence Search
   1::924
 537::921  PF00476 0.0% 42.7440633245383  DNA polymerase family A 
  10::178  PF02739 0.0% 41.9753086419753  5'-3' exonuclease, N-terminal resolvase-like domain 
 324::506  PF01612 0.0% 35.4651162790698  3'-5' exonuclease 
 181::279  PF01367 0.0% 51.5151515151515  5'-3' exonuclease, C-terminal SAM fold 
   1::924


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKIKKTDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
PF00476         ----------------------------------------------------------------------
PF02739         ---------llLiDgsslafRaffalpkkeltnskgeptnavygflksllkllke.......ekpeyvvv
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
PF00476         ----------------------------------------------------------------------
PF02739         vfDakkktfRkelyeeYKanRektpeelleqiplikellealgiavleaegyEADDvigtlakkaekegv
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
PF00476         ----------------------------------------------------------------------
PF02739         evkivsgDkDllQlvsdkvkvavlkkglaeaelltpee--------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------tpeqiidlkaLvGDsSDnipGvkgiGektA


                         -         -         -         +         -         -         -:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKNKLYK
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         akLLkeygslenilenldklkkkklrekleaakeeaklskkLatlktdvplelsledlklkeadkeeli-


                         -         *         -         -         -         -         +:350
query           FLREMEFNRLLSSVISAYGEPLLEETAKETKPEKKHQNISKKNYHLITNEKEIDEWINEAEEAGELAIDT
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         -------------------------------------------yeivtteeeleelieelknlkvvavDt
PF01367         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         Ettsldlisatlrlaliqigtkeeayiidpleledd......lellkklledenitkVghnakfDlevla
PF01367         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
PF00476         ----------------------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         rdfgielenlfdtmlaaavldyees.hsLasLaekllgeleldkeeqiakwqk....arplleeqleYAa
PF01367         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVF
PF00476         ----------------------------------------------daeeleelteelkaqlaklekklp
PF02739         ----------------------------------------------------------------------
PF01612         eDadvllrlfkkLeke------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
PF00476         elageefNvgspkqlqellfeelglpklkktkksGarsteadvleslaedaheliksqlevrklsklkst
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
PF00476         vvdkldleieaedgrihtsvnqagtiTgRlsstepnlqniprrdevGseiraafiaeegyvlvaaDysqi
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
PF00476         elrilahlsddeflieafetgadlhtltaakifgvdleevtgesRraaKtfnfGliYGagakglsqlLgi
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
PF00476         skeeakelaekyfartpgvkklrekirkeakkkGyvstlfgkrrelPdldsrnrslresaeraalNtpiQ
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
PF00476         ssaaDilklalikleellee.kglkarlllqvHDEivlevrkeeaeavakqikelmeramel.....dvl
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TVDVNTGDNWGILH--------------------------------------------------------
PF00476         llveleqgrnw-----------------------------------------------------------
PF02739         ----------------------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF01367         ----------------------------------------------------------------------