[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21058.1


[Show Plain Result]

## Summary of Sequence Search
   1::967
 612::806  PF02779 0.0% 47.7272727272727  Transketolase, pyrimidine binding domain 
 229::545  PF00676 0.0% 25.3472222222222  Dehydrogenase E1 component 
   1::967


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSSKNLEFEKTSFLSKSNSAFIEQMYLKFINKDKDLPESWQNYFEGMSEDLSMIAKEINGPSWNIKKKI
PF02779         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DIDEVEKRIEEDEKKLSNEGNIAKVNSKDLVKSNINSIRAVALIRAYRQRGHLLAKLDPLGMMETEYLDE
PF02779         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LHPEHYGFKKENYDEKIYLDGVINKEHSSIKEILNFLNKTYCGPIGYEYMHISNPTERKWLRDRIEQDEN
PF02779         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SLQFTKNGKEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
PF02779         ----------------------------------------------------------------------
PF00676         ------------------lrrmedalaalykrkkrigfvhlsagqealqvgiaaaleke..Dlvi.stYR


                         -         *         -         -         -         -         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
PF02779         ----------------------------------------------------------------------
PF00676         ehgvllargvs..leevlaeltgke.....kgkggsmh.eisyaekksrflggngivgaq.........v


                         -         -         -         -         *         -         -:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
PF02779         ----------------------------------------------------------------------
PF00676         plvaGialaak.....yegkkevailliGDGa.tnqGqffealnlAalwklpv...ifvveNNqyaiste


                         -         -         +         -         -         -         -:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
PF02779         ----------------------------------------------------------------------
PF00676         aerssaskelakkargvgipgirVdGnDvlAvyqAvkeAaeraregkgPvLielvtYRyggHsesDdpst


                         *         -         -         -         -         +         -:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPE
PF02779         ----------------------------------------------------------------------
PF00676         yrtreeveevrkkkdpikrlkehlvkkgvvseeelkeiekevrkeieeavkkaee---------------


                         -         -         -         *         -         -         -:630
query           KGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFGSLLEEG
PF02779         ---------------------------------------------------kiawrkaeaealaellked
PF00676         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
PF02779         prvvllgaDvagGtfsvrkgllhdqg................egrvidsgisEqavlgfavGlalagp.l
PF00676         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
PF02779         lviveaqFgdFangAqiyadaairsgealgklpvgvvtrlpigvgedGpehqsaeleaflrlipg..lkv
PF00676         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LNCTTPANYYHALRRQMHREFRKPLIIMTPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKL
PF02779         vrPsdpaeakgllrraieredrkPvvlrlpkqllrh----------------------------------
PF00676         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKN
PF02779         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           MGAWFSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQEIIKKVFE-------------
PF02779         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------