[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21098.1


[Show Plain Result]

## Summary of Sequence Search
   1::422
  15::155  PF01565 0.0% 29.5454545454545  FAD binding domain 
 399::418  PF02913 0.0% 45  FAD linked oxidases, C-terminal domain 
   1::422


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKNSQIFQDSNNTYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
PF01565         --------------vrpeseeevaaivrlarekglpvlvrGgGssll.gqavtggvvldlsrlnrileid
PF02913         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PEELYIKVKANTPLELVEKELEKNNQELAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
PF01565         eeegtatveaGvtlgdleealaakglllglep........gslipgtvGGaiatngggygsekyGlirdn
PF02913         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDKKLV
PF01565         vlslevvladGevvr-------------------------------------------------------
PF02913         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KNLFDKISSSSSEVSGAVYIPEEPKDENYDQNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKALTNE
PF01565         ----------------------------------------------------------------------
PF02913         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LELSKLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWI
PF01565         ----------------------------------------------------------------------
PF02913         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYR
PF01565         ----------------------------------------------------------------------
PF02913         ------------------------------------------------lmrriKaalDPnniLNPgkv--


                         -         -         +         -         -         -         -:490
query           GI--------------------------------------------------------------------
PF01565         ----------------------------------------------------------------------
PF02913         ----------------------------------------------------------------------