[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21102.1


[Show Plain Result]

## Summary of Sequence Search
   1::169
  47::169  PF09411 0.0% 23.5772357723577  Lipid A 3-O-deacylase (PagL) 
   1::169


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKHYKLISRFIFIIFFSLLSSVVYAEENSSKFNVYSGMFDFSDTGKKSTLIGFQHQNEDLNRDTFLGNIS
PF09411         ----------------------------------------------dgadlalrydfnplllewsggrls


                         -         -         *         -         -         -         -:140
query           PITGALVTADSAAYIYTGVQAQYKLGKINFTPSFAPGLYSKGDGKDLGHILEFKSELQISVDFVSNSQLG
PF09411         lrvelgvnlwtsgeesalelGlspvvrleqtggssklyleagigvallsktrdedkdlgtafqFedqlgl


                         +         -         -         -         -         *         -:210
query           FSYNHLSNASLGTKNPGANSYMFNFFKTF-----------------------------------------
PF09411         GyqfgdrasvglryqHlSNagikdpNpGl-----------------------------------------