[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21174.1


[Show Plain Result]

## Summary of Sequence Search
   1::213
  24::197  PF02527 0.0% 28.5714285714286  rRNA small subunit methyltransferase G 
   1::213


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQEENEKINIISKETAKNEVIRERHIVDSAQIIEFVDLNS
PF02527         -----------------------lekYlelllewNkklnLtsik.elee.llerhlldslsllellkekr


                         -         -         *         -         -         -         -:140
query           NIITDIGSGGGMPGIIISIMIKNQKNLAKVHLYEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSG
PF02527         skviDvGsGaGlPGipLaiarpelk....ltLleskekkiaFLeelkkelklenveivearaeekqeeek


                         +         -         -         -         -         *         -:210
query           TIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLEETLMNWDFDFEKKKSITSEDSFLLNIKKIK
PF02527         ydvitsRAlaslneltelalkllksgglilalKGkkaedeleelekklqlskvevls-------------


                         -         -         -         +         -         -         -:280
query           KKN-------------------------------------------------------------------
PF02527         ----------------------------------------------------------------------