[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21175.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   4::225  PF01656 0.0% 36.1702127659574  CobQ/CobB/MinD/ParA nucleotide binding domain 
   3::43   PF09140 0.0% 41.4634146341463  ATPase MipZ 
 105::165  PF09140 0.0% 26.2295081967213  ATPase MipZ 
   7::46   PF00142 0.0% 52.5  4Fe-4S iron sulfur cluster binding proteins, NifH/f 
 196::260  PF00142 0.0% 24.6153846153846  4Fe-4S iron sulfur cluster binding proteins, NifH/f 
   7::177  PF02374 0.0% 23.780487804878  Anion-transporting ATPase 
   1::39   PF07015 0.0% 38.4615384615385  VirC1 protein 
 113::154  PF07015 0.0% 30.952380952381  VirC1 protein 
   1::148  PF06564 0.0% 27.972027972028  YhjQ protein 
  12::40   PF00448 0.0% 51.7241379310345  SRP54-type protein, GTPase domain 
  72::195  PF00448 0.0% 15.3846153846154  SRP54-type protein, GTPase domain 
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
PF01656         ---iaiaggkGGvGKTtlaanLaralakrglrVlliDlDpqannssllgkv...................
PF09140         --vivlgnekGGsGksttavhvavaLlkkgakvaaiDlDlrqr---------------------------
PF09140         --vivlgnekGGsGksttavhvavaLlkkgakvaaiDlDlrqr---------------------------
PF00142         ------iYGkGGiGksttsqnlaaalaemgkkvlivGCDPkaDstr------------------------
PF00142         ------iYGkGGiGksttsqnlaaalaemgkkvlivGCDPkaDstr------------------------
PF02374         ------fgGKGGVGKttvsaatavklseqgkkvllvstDPAhslsdsfdq.kigkeptkvkgvenLsavE
PF07015         mklitfcslkGGaGkttalmglcsalasdgkrvalfead-------------------------------
PF07015         mklitfcslkGGaGkttalmglcsalasdgkrvalfead-------------------------------
PF06564         mavlaLqGvrGGvGttsllaaLgwalqelgesvLviDlsPdnlLrlsfnv.dleqseGWaraeldgrdwr
PF00448         -----------GaGKTTtlaKLAallkkegkkvllvaaDt------------------------------
PF00448         -----------GaGKTTtlaKLAallkkegkkvllvaaDt------------------------------


                         -         -         *         -         -         -         -:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
PF01656         .eilkkglekasal......lenfeagllaegeeg.lvesllkkalealikea...yDvviiDgapglge
PF09140         ----------------------------------esaevaeleeavaeleaeaDfiviDtPGsdsalsrl
PF09140         ----------------------------------esaevaeleeavaeleaeaDfiviDtPGsdsalsrl
PF00142         ----------------------------------------------------------------------
PF00142         ----------------------------------------------------------------------
PF02374         idpqeeleearqevvkeeeavlgleele.dvlaeelaslpgideiasfdellklvk..eeeydvvifDtA
PF07015         ------------------------------------------aayeeaegeGfdyaladtrgGsselnnt
PF07015         ------------------------------------------aayeeaegeGfdyaladtrgGsselnnt
PF06564         daalryle..gldlLP.fGqLsaaerenlealqedlsaiaealqklkas.eryrWvLlDlPagesaltre
PF00448         -DtfRaaAveQLktlaeklgvpvikekeekdp..aavakeave...kakeekidvvlvDTaGrlqndkel
PF00448         -DtfRaaAveQLktlaeklgvpvikekeekdp..aavakeave...kakeekidvvlvDTaGrlqndkel


                         +         -         -         -         -         *         -:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNE
PF01656         lvanalqaadllvvviepekfsvegakrilellerlgkk....lkilgvvlnkvdrgnerhleeeveale
PF09140         ahsladtlvtPlnDsfvDfDllakv---------------------------------------------
PF09140         ahsladtlvtPlnDsfvDfDllakv---------------------------------------------
PF00142         -------------------------------------------------------rkvdkekelieefae
PF00142         -------------------------------------------------------rkvdkekelieefae
PF02374         PTGhtlrlLslpevlekll...eklvklknklsplak---------------------------------
PF07015         iiassdllliPtml--------------------------------------------------------
PF07015         iiassdllliPtml--------------------------------------------------------
PF06564         lleladvt--------------------------------------------------------------
PF00448         meelkkikkvlkpdevllvldatigq.ealk.qakaFkeaveltgviltklDgda---------------
PF00448         meelkkikkvlkpdevllvldatigq.ealk.qakaFkeaveltgviltklDgda---------------


                         -         -         -         +         -         -         -:280
query           KVYLTVIPRNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQEQTIGSAA----------------
PF01656         rklgvpvvlpgeipr-------------------------------------------------------
PF09140         ----------------------------------------------------------------------
PF09140         ----------------------------------------------------------------------
PF00142         klgtkllevvPrdnivrkaelrkktvieyaeeseqakeyrelakkilene--------------------
PF00142         klgtkllevvPrdnivrkaelrkktvieyaeeseqakeyrelakkilene--------------------
PF02374         ----------------------------------------------------------------------
PF07015         ----------------------------------------------------------------------
PF07015         ----------------------------------------------------------------------
PF06564         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF00448         ----------------------------------------------------------------------