[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21176.1


[Show Plain Result]

## Summary of Sequence Search
   1::282
  29::120  PF02195 0.0% 40.4494382022472  ParB-like nuclease domain 
   1::282


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDANKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
PF02195         ----------------------------evplseirpsplqprld.spekleelvasikeagllqPiivr


                         -         -         *         -         -         -         -:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEE
PF02195         kvr..qgryeiidGerRlrAakrlgakevpvivleltdeeamalsleeni--------------------


                         +         -         -         -         -         *         -:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVR
PF02195         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QSENFVKIFKTKKHSLKTSKDINLQVLENSIREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIEIIKS
PF02195         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NY--------------------------------------------------------------------
PF02195         ----------------------------------------------------------------------