[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21179.1


[Show Plain Result]

## Summary of Sequence Search
   1::844
  12::364  PF00133 0.0% 28.4280936454849  tRNA synthetases class I (I, L, M and V) 
 419::575  PF00133 0.0% 21.830985915493  tRNA synthetases class I (I, L, M and V) 
 615::655  PF00133 0.0% 46.3414634146341  tRNA synthetases class I (I, L, M and V) 
  40::225  PF09334 0.0% 36.4130434782609  tRNA synthetases class I (M) 
 414::440  PF09334 0.0% 41.6666666666667  tRNA synthetases class I (M) 
 614::661  PF09334 0.0% 35.4166666666667  tRNA synthetases class I (M) 
 695::804  PF08264 0.0% 32.1100917431193  Anticodon-binding domain 
  45::160  PF01406 0.0% 23.8938053097345  tRNA synthetases class I (C) catalytic domain 
 613::645  PF01406 0.0% 36.3636363636364  tRNA synthetases class I (C) catalytic domain 
  40::73   PF00750 0.0% 41.1764705882353  tRNA synthetases class I (R) 
 775::839  PF00750 0.0% 22.9508196721311  tRNA synthetases class I (R) 
  31::72   PF01921 0.0% 30.952380952381  tRNA synthetases class I (K) 
 608::650  PF01921 0.0% 27.906976744186  tRNA synthetases class I (K) 
   1::844


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGY
PF00133         -----------kilekWeeedlfkkslekekekekFvlvdgPPnatGslHiGhalaktlkdivirykrmk
PF00133         -----------kilekWeeedlfkkslekekekekFvlvdgPPnatGslHiGhalaktlkdivirykrmk
PF00133         -----------kilekWeeedlfkkslekekekekFvlvdgPPnatGslHiGhalaktlkdivirykrmk
PF09334         ---------------------------------------lpYvngkpHlGhlystiaaDvlarykrlrge
PF09334         ---------------------------------------lpYvngkpHlGhlystiaaDvlarykrlrge
PF09334         ---------------------------------------lpYvngkpHlGhlystiaaDvlarykrlrge
PF08264         ----------------------------------------------------------------------
PF01406         --------------------------------------------dashlGhaRslvvfDvlrrilqalgY
PF01406         --------------------------------------------dashlGhaRslvvfDvlrrilqalgY
PF00750         ---------------------------------------spNiakeiHvGhlRstiiGdalsrlleflGy
PF00750         ---------------------------------------spNiakeiHvGhlRstiiGdalsrlleflGy
PF01921         ------------------------------ekdevvvesGispSGliHiGnlrevltadlvakalrkrge
PF01921         ------------------------------ekdevvvesGispSGliHiGnlrevltadlvakalrkrge


                         -         -         *         -         -         -         -:140
query           NVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFL
PF00133         GkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyaeeirkqvkrLGvsvdwd
PF00133         GkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyaeeirkqvkrLGvsvdwd
PF00133         GkdveyvpGwDhhGlpieakvekklgkkekkereklgrekfrekvrewkaeyaeeirkqvkrLGvsvdwd
PF09334         evlfvtgtDehGtkielkAekegltpqelvdkvseefkelfkk..lnisfDkfirTtseehkelvqeffk
PF09334         evlfvtgtDehGtkielkAekegltpqelvdkvseefkelfkk..lnisfDkfirTtseehkelvqeffk
PF09334         evlfvtgtDehGtkielkAekegltpqelvdkvseefkelfkk..lnisfDkfirTtseehkelvqeffk
PF08264         ----------------------------------------------------------------------
PF01406         dvqfvqnvtDidDkiikrarqeeksvkelaekfieeykkdleaLnvl...kptletrvtekideiielve
PF01406         dvqfvqnvtDidDkiikrarqeeksvkelaekfieeykkdleaLnvl...kptletrvtekideiielve
PF00750         kvv-------------------------------------------------------------------
PF00750         kvv-------------------------------------------------------------------
PF01921         ev--------------------------------------------------------------------
PF01921         ev--------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALEN
PF00133         reylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEv.eykdvk..............
PF00133         reylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEv.eykdvk..............
PF00133         reylTldeeleeavievfvelakkGliyrgkklvnwstklktalselEv.eykdvk..............
PF09334         klkekgliyekeieqlYcvsderflpdryvegtcPkcksekargdqceecgkklepkelinpksaisgsk
PF09334         klkekgliyekeieqlYcvsderflpdryvegtcPkcksekargdqceecgkklepkelinpksaisgsk
PF09334         klkekgliyekeieqlYcvsderflpdryvegtcPkcksekargdqceecgkklepkelinpksaisgsk
PF08264         ----------------------------------------------------------------------
PF01406         kliekgyaYvssdgdvyfdv--------------------------------------------------
PF01406         kliekgyaYvssdgdvyfdv--------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WPNKVKVMQKNWIGKSFGCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQK
PF00133         ..................................dalihvafpladkke.aklviwTTtPwTllgn..ta
PF00133         ..................................dalihvafpladkke.aklviwTTtPwTllgn..ta
PF00133         ..................................dalihvafpladkke.aklviwTTtPwTllgn..ta
PF09334         pevkeeehyffklsk-------------------------------------------------------
PF09334         pevkeeehyffklsk-------------------------------------------------------
PF09334         pevkeeehyffklsk-------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FREECSKTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFA
PF00133         vav.npeleyvvedell.ilaeallesllkkkkeeledergkeLegkkvelplldreipiiadeyvdkea
PF00133         vav.npeleyvvedell.ilaeallesllkkkkeeledergkeLegkkvelplldreipiiadeyvdkea
PF00133         vav.npeleyvvedell.ilaeallesllkkkkeeledergkeLegkkvelplldreipiiadeyvdkea
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNYRLK
PF00133         GtGiVkiaPahged------------------------------------------------------iq
PF00133         GtGiVkiaPahged------------------------------------------------------iq
PF00133         GtGiVkiaPahged------------------------------------------------------iq
PF09334         ---------------------------------------------------------------wlkegLk
PF09334         ---------------------------------------------------------------wlkegLk
PF09334         ---------------------------------------------------------------wlkegLk
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFILDGKKYRRETD
PF00133         dWcisRqrwWGtripvwvsketeevvvreelkelvakrleeeaeekalekeakdkl...kkekgklekde
PF00133         dWcisRqrwWGtripvwvsketeevvvreelkelvakrleeeaeekalekeakdkl...kkekgklekde
PF00133         dWcisRqrwWGtripvwvsketeevvvreelkelvakrleeeaeekalekeakdkl...kkekgklekde
PF09334         dlsisrdlkwGipvp...ed--------------------------------------------------
PF09334         dlsisrdlkwGipvp...ed--------------------------------------------------
PF09334         dlsisrdlkwGipvp...ed--------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLK
PF00133         dvlDvWFdSgstpfsvlgypee.....ntkefkkffpadllleGlD..qirgWvarlillslaltgke..
PF00133         dvlDvWFdSgstpfsvlgypee.....ntkefkkffpadllleGlD..qirgWvarlillslaltgke..
PF00133         dvlDvWFdSgstpfsvlgypee.....ntkefkkffpadllleGlD..qirgWvarlillslaltgke..
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENII
PF00133         ...pykevlvhglvl---------------------------------------KMSKslgNvidpldvi
PF00133         ...pykevlvhglvl---------------------------------------KMSKslgNvidpldvi
PF00133         ...pykevlvhglvl---------------------------------------KMSKslgNvidpldvi
PF09334         -----------------------------------------------------ekmSkSrgnvvdpeell
PF09334         -----------------------------------------------------ekmSkSrgnvvdpeell
PF09334         -----------------------------------------------------ekmSkSrgnvvdpeell
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------gekmsksLknfltikdvl
PF01406         ----------------------------------------------------gekmsksLknfltikdvl
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         -----------------------------------------------illkggekmssSkGnvitvedwl
PF01921         -----------------------------------------------illkggekmssSkGnvitvedwl


                         -         +         -         -         -         -         *:700
query           KNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNNDQGSEGNDLAKFTNQLI
PF00133         kkygadalRltliassdvgrdinls---------------------------------------------
PF00133         kkygadalRltliassdvgrdinls---------------------------------------------
PF00133         kkygadalRltliassdvgrdinls---------------------------------------------
PF09334         eelgvdalRYyllreapekkDsdfseeelve---------------------------------------
PF09334         eelgvdalRYyllreapekkDsdfseeelve---------------------------------------
PF09334         eelgvdalRYyllreapekkDsdfseeelve---------------------------------------
PF08264         ----------------------------------------------------------------elneli
PF01406         kkfdprqlRllllsa-------------------------------------------------------
PF01406         kkfdprqlRllllsa-------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         evaepevlrfliarkkPkka--------------------------------------------------
PF01921         evaepevlrfliarkkPkka--------------------------------------------------


                         -         -         -         -         +         -         -:770
query           NKITQNLEKFHYNVIVANFYEMYNFLIKEIDKPIKKEILIENYKKILIVMNPFIPHFSNECLSTINENQI
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         kevteayeeyrfnkavsalyeffwndlcdwylelvkprlysesaedsrraqyvllevletllrllaPimP
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           SWPEISKEDLIEEDINFVVQINGKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDKTIKKSIFVPNRLI
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         fltEelwqrleeeklgkeesimlaewpe.dseel------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----kakdalkerarsyvvllesedee....frkawkkklvdlikselnkiytdldvtliegesvkker-
PF00750         ----kakdalkerarsyvvllesedee....frkawkkklvdlikselnkiytdldvtliegesvkker-
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           NIIL------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------