[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21236.1


[Show Plain Result]

## Summary of Sequence Search
   1::462
  14::307  PF00206 0.0% 28.9115646258503  Lyase 
 338::382  PF00206 0.0% 24.4444444444444  Lyase 
   1::462


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVKNKNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQKIISFKIKNKIIFGLN
PF00206         -------------rftvkadklmgifterlrenfrlseedikalaalkkaaakanvelkeeaaaiikald
PF00206         -------------rftvkadklmgifterlrenfrlseedikalaalkkaaakanvelkeeaaaiikald


                         -         -         *         -         -         -         -:140
query           KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
PF00206         evleegklddafvlkviqegsgtavnmnlneviaellgqkvepndkvhtgqSsnDqvpTalrlalkkals
PF00206         evleegklddafvlkviqegsgtavnmnlneviaellgqkvepndkvhtgqSsnDqvpTalrlalkkals


                         +         -         -         -         -         *         -:210
query           IIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTS
PF00206         ekLlpaleqLidalkekakefkdvvkiGrThlqdAtPvtlgqelsayaealerdlerlkellkrllvell
PF00206         ekLlpaleqLidalkekakefkdvvkiGrThlqdAtPvtlgqelsayaealerdlerlkellkrllvell


                         -         -         -         +         -         -         -:280
query           FNIDRNFTSKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVV
PF00206         gggtavgtglnadpefaelvakelakitglpvkaansfeavsdrDavvellgalkllavsLskiaeDlrl
PF00206         gggtavgtglnadpefaelvakelakitglpvkaansfeavsdrDavvellgalkllavsLskiaeDlrl


                         -         *         -         -         -         -         +:350
query           TGSSIMPQKKNPDLLEYLRGKTGTVYGNLFSMLTILKGLPISYFKDLQDDKEILFKSNEILNNSIAILNE
PF00206         lssgpaglvelslaesepGSSiMPgKv------------------------------keeaaaiikalde
PF00206         lssgpaglvelslaesepGSSiMPgKv------------------------------keeaaaiikalde


                         -         -         -         -         *         -         -:420
query           VLKNLKPNKQQMLDLANSGYITATDLADYLVKNHSMPFRKAYQTTASIVNYAEKKKKKLNELNIDELKKI
PF00206         vleegklddafvlkviqegsgtavnmnlnevi--------------------------------------
PF00206         vleegklddafvlkviqegsgtavnmnlnevi--------------------------------------


                         -         -         +         -         -         -         -:490
query           EPRLTIEVLKIFNVKNSVNSKKSYGGTSFDNIKKMIMKYKKT----------------------------
PF00206         ----------------------------------------------------------------------
PF00206         ----------------------------------------------------------------------