[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21245.1


[Show Plain Result]

## Summary of Sequence Search
   1::299
 108::215  PF02559 0.0% 34.7368421052632  CarD-like/TRCF domain 
   1::299


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKTSTTNILAKIFKKTPEKKVKKKTKAKVAKKPTLPKAKVVKKKIPVKKTKTIKATPTKIKKNLKTVSK
PF02559         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVET
PF02559         -------------------------------------elkvGdlVVhpehGvGriegieekevggekrey


                         +         -         -         -         -         *         -:210
query           YVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAE
PF02559         lvleyaend.klyvPvenldlis.ryigseeev.pvldkLggks......wkkrka....klksgiieia


                         -         -         -         +         -         -         -:280
query           VVRDLNKGDDLMVDQSYSERQLFEKAYERILSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAPTKI
PF02559         aellk-----------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KEPITESDTDSEPITDTED---------------------------------------------------
PF02559         ----------------------------------------------------------------------