[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21331.1


[Show Plain Result]

## Summary of Sequence Search
   1::203
  82::166  PF01751 0.0% 20  Toprim domain 
  39::76   PF02132 0.0% 24.3243243243243  RecR protein 
   1::203


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNINEIEELIKLISKLPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGC
PF01751         ----------------------------------------------------------------------
PF02132         --------------------------------------ealqLaeaLseakekvrhCsvCgnlteed.pC


                         -         -         *         -         -         -         -:140
query           NNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVI
PF01751         -----------vliivEgpsdakaiakalgkeltvtaslGhlvdldtkekkkkdkkevlkllkelakead
PF02132         eICsdp----------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LATSATVEGQTTAYYIEDSLKKTSTKVTKLAQGLPVGGEIESLDDGTLYSAFKNRTGIKTNSD-------
PF01751         eviiatDpDreGekiawellellkpk--------------------------------------------
PF02132         ----------------------------------------------------------------------