[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21387.1


[Show Plain Result]

## Summary of Sequence Search
   1::437
 188::361  PF04932 0.0% 25.3424657534247  O-Antigen ligase 
   1::437


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHLYQNKKDTLLYLLYVFPIILVFSKFLAEILILVTLCYLILFNKKVTFQIIKKDFFFKSFLVYICILII
PF04932         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSFFSADILPSLKRSVSYFRFIFFIIFIKYFFLTNEKRFINFLLITSLFLIILSLDIFFQFFNGKDILGH
PF04932         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PSVSEGKRNSGFFGDEFIAGGYIVLFFFPCLLLSNINKYKNIILFLIIIFPTTIVITGERSSLFLMFLGL
PF04932         -----------------------------------------------llsllalfltnsRsaiigvlval


                         -         -         -         +         -         -         -:280
query           ILSLPLLIRDKRLSIALISSLILMTLTINFSSNVNNRIIQTTISQVTKGFDNKYFQNKEFVKEYDENSIN
PF04932         ivlillfyknlikrwllkli.iviiliilfviitfaflkldkvfklidnkivtlidgstknsedlqtd..


                         -         *         -         -         -         -         +:350
query           NKKNRIGFLNSGWGAHILTAVEIWRDYPIYGSGLKTFRKLCSNEKYEKIKSLNFKNRCATHPHQIYFEIL
PF04932         ......................ssRgyiwkralrlikdtpilGtGpdtfvtqgdaryky...yayettgt


                         -         -         -         -         *         -         -:420
query           SETGVIGFFSIIIIFIIILNRMFKILIVNKKEYSSILVLFTPIIIKLWPLTTTGSFFSNYNLILLSFFIG
PF04932         vvdsaHNlyLq-----------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FVLSLENLDINKLTKFS-----------------------------------------------------
PF04932         ----------------------------------------------------------------------