[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21392.1


[Show Plain Result]

## Summary of Sequence Search
   1::312
   8::239  PF01370 0.0% 37.10407239819  NAD dependent epimerase/dehydratase family 
   7::67   PF04321 0.0% 40  RmlD substrate binding domain 
   1::312


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MINRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQIKVIKFLKKKKPDFIFIAAAKVGG
PF01370         -------ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdltdkdalerlfa
PF04321         ------rilvtGanGqlGteLaralkeegvevval.dreeldltdpeavaalvkeakpdvvvnaAAy---


                         -         -         *         -         -         -         -:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
PF01370         eeqpdaVihlaaesg.vdassedpadfiennvvgtlnlleaarkagvkrlvflsSsevYgkdaeepikEe
PF04321         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKNTVILWGNGKAK
PF01370         tpl.gplsp....YaaaKlageklveayareyglraiilrlfnvyGpr.nfdeeetkvipalirril...
PF04321         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           REVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNKKIKIKYDKTKPNGSPRKVM
PF01370         .egeeeltllgdGtqlRdflyveDvarai-----------------------------------------
PF04321         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DISLAKKYGWKSKMSLITSIRNTYKSFVRENF--------------------------------------
PF01370         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------