[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21400.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
  27::166  PF06242 0.0% 53.5714285714286  Protein of unknown function (DUF1013) 
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATAVWLVENTTLTFKQISKFCNLHEVEVQGIADGEVAKGIMAYNPIISGQLTREEIELASKDENKELQI
PF06242         --------------------------lEvkaiAdgevakgikgldPiangqltreeiekcekdpnaklkl


                         -         -         *         -         -         -         -:140
query           KNTDIEISTEDKKIKKYIPLSKRQDKPDSALWLIKHHSLLKDSQIAKLVGITKASVTAIKNKSYWNYNNL
PF06242         skkkeevkekkrkgarYtpvskRqdkpdailwllknhpelkdaqivkligttkktieairdrshwNsani


                         +         -         -         -         -         *         -:210
query           NPKDPVALGLFSQKDLIEAIEKAERRIKREKKEKEKAKLTREVSNIE-----------------------
PF06242         kprdPvtlgLcsqidLdaavekaakk--------------------------------------------