[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21405.1


[Show Plain Result]

## Summary of Sequence Search
   1::336
   3::332  PF00274 0.0% 49.6969696969697  Fructose-bisphosphate aldolase class-I 
   1::336


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSELNKIALKILSNGKGILAADESNGTMTKRLESVNVPSSPENRLLFRETLFSSSGMKDFIGGVILYDET
PF00274         --eLietakaivapgkGilAaDestgtigkrlasigventeenrrayRellftteglgeyisgvIlfeet


                         -         -         *         -         -         -         -:140
query           INQTSNLKQTIPELISESGAVPGIKVDTGAKILAGSHEEKITEGLDGLRERLKDYYKLGARFTKWRGVFN
PF00274         lyqktkdGkpfvellkekgivpGiKvDkglvplagtagetttqglDglaeRaaeykkaGarFaKwRavlk


                         +         -         -         -         -         *         -:210
query           ISDKYPSKLSIHSNAHALARYSALVQECGMVPIVEPEVLMDGDHAAETCFNKTSEVIQKCFEELLLHKID
PF00274         iskntpselaieenanvlaryaaicqengLVPIvePeilldgdhdlercqevtekvlaavfkalsdhhVl


                         -         -         -         +         -         -         -:280
query           LSGIILKPNMILAGTTSDKKISSEEVAKLTLKCLKENVPTDVPGIAFLSGGQTEVEATENLNLINKYNDT
PF00274         legtllkpnmvtpGadckkkaspeevaeatvralrrtvPaavpgvvfLSGgqseeeatlnLnainklpkk


                         -         *         -         -         -         -         +:350
query           NFIMTYSYGRALQQSALKFWSKDINNTSGTQKVFNHRANMCTLAAQGKWSKELEAK--------------
PF00274         kpwklsfSygrALqasvlkawkgkkenvkaaqeallkrakanseaslGkyek------------------