[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21413.1


[Show Plain Result]

## Summary of Sequence Search
   1::241
   5::236  PF01709 0.0% 53.448275862069  Domain of unknown function DUF28 
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
PF01709         ----skwanikhrkakqdakrsklftklskeItvaakeGgpdpesNprLraaiekAkkanmpkdnIeraI


                         -         -         *         -         -         -         -:140
query           AKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGIIK
PF01709         kkasgkeegenyeevrYEgygpggvavivealTDnknRtaadvrsafsknggnlgesgsvsflFekkgvi


                         +         -         -         -         -         *         -:210
query           IDKKEISDEQIFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEK
PF01709         eikkeeadedelleaaleagaedveeedesievitepedlekvkkaLeeagleieeaeleliPkntvevd


                         -         -         -         +         -         -         -:280
query           DKVEAALEFLETLEDDDDVQSVYSNINFKNN---------------------------------------
PF01709         eedaekleklldaLedldDVqnvytn--------------------------------------------