[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21432.1


[Show Plain Result]

## Summary of Sequence Search
   1::637
 319::479  PF02779 0.0% 30  Transketolase, pyrimidine binding domain 
 495::618  PF02780 0.0% 34.9593495934959  Transketolase, C-terminal domain 
  26::185  PF00456 0.0% 28.75  Transketolase, thiamine diphosphate binding domain 
 240::300  PF00456 0.0% 27.1186440677966  Transketolase, thiamine diphosphate binding domain 
 109::182  PF00676 0.0% 29.1666666666667  Dehydrogenase E1 component 
   1::637


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         -------------------------kavnaiRvlavdavekaksGHPgaplglaeiaevlfkktlkhnpk
PF00456         -------------------------kavnaiRvlavdavekaksGHPgaplglaeiaevlfkktlkhnpk
PF00676         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         dpkwidrDRFvLSnGHaslllYallhltGydlsleelksfrqlgsktpGHPelkeaagvevttGpLGqGi
PF00456         dpkwidrDRFvLSnGHaslllYallhltGydlsleelksfrqlgsktpGHPelkeaagvevttGpLGqGi
PF00676         --------------------------------------rflggngivgaqvplva..Gialaakyegkke


                         +         -         -         -         -         *         -:210
query           NIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKL
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         anavglalaekalaatynkpgfdivdhyvyvllgDgclmEGvssE-------------------------
PF00456         anavglalaekalaatynkpgfdivdhyvyvllgDgclmEGvssE-------------------------
PF00676         vailliGDGatnqGqffealnlAalwklpvifvveNNqyais----------------------------


                         -         -         -         +         -         -         -:280
query           IVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIK
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         -----------------------------feaygWhvievedgedveeiakAieeAkaekdk.Ptlikvk
PF00456         -----------------------------feaygWhvievedgedveeiakAieeAkaekdk.Ptlikvk
PF00676         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TQKGKGYSYAEKASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG
PF02779         --------------------------------------awrkaeaealaellkedprvvllgaDvagGtf
PF02780         ----------------------------------------------------------------------
PF00456         tviGfgspnkeg.kedvHGa--------------------------------------------------
PF00456         tviGfgspnkeg.kedvHGa--------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           MDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA
PF02779         svrkgllhdqgegrvidsgisEqavlgfavGlalagpllviveaqFgdFangAqiyadaairsgealgkl
PF02780         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDE
PF02779         pvg.vvtrlpigvgedGpehqsaeleaflrlipglkvvrPsdpaeakgllrraieredr-----------
PF02780         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           NIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMIT
PF02779         ----------------------------------------------------------------------
PF02780         ----gkaevdregkdvtivayGsmveealeAaeeLakegisaevidlrtvkPlDeetidesvkktgrlvv
PF00456         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           VEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDILFTKE
PF02779         ----------------------------------------------------------------------
PF02780         veeavkrgGigaevaaalaeegfdaldapvrrvggpdvpipha.aalelaylgltaek------------
PF00456         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SIKVVKN---------------------------------------------------------------
PF02779         ----------------------------------------------------------------------
PF02780         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00456         ----------------------------------------------------------------------
PF00676         ----------------------------------------------------------------------