[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21456.1


[Show Plain Result]

## Summary of Sequence Search
   1::131
  45::113  PF00717 0.0% 28.3582089552239  Peptidase S24-like 
   1::131


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLTIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKP
PF00717         --------------------------------------------rvpGdSM.eptlldGdlvlVdktsep


                         -         -         *         -         -         -         -:140
query           KNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIHSTY---------
PF00717         krGdiVvfrlpgdeeayvKrliglpgdkvlipsnnn.ykdlyi---------------------------