[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21514.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
  11::231  PF07690 0.0% 23.2876712328767  Major Facilitator Superfamily 
 205::393  PF07690 0.0% 21.7877094972067  Major Facilitator Superfamily 
  43::149  PF05977 0.0% 21.4953271028037  Bacterial protein of unknown function (DUF894) 
 235::388  PF05977 0.0% 23.5714285714286  Bacterial protein of unknown function (DUF894) 
  35::98   PF06779 0.0% 23.8095238095238  Protein of unknown function (DUF1228) 
  41::173  PF00083 0.0% 17.2932330827068  Sugar (and other) transporter 
 217::286  PF00083 0.0% 14.2857142857143  Sugar (and other) transporter 
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKVLKNSWALFLGIGFLMMAYGFQGSLLGVRAVQEQFSLTATGFMMSGYFVGYFIGAMTISNLISKVGH
PF07690         ----------lllaaflaalarsilgpalpl.alaedlgispseigwlltlyslgyaiasllaGrlsdrf
PF07690         ----------lllaaflaalarsilgpalpl.alaedlgispseigwlltlyslgyaiasllaGrlsdrf
PF05977         ------------------------------------------yGillgalGaGAvlgalllsrlrrrlss
PF05977         ------------------------------------------yGillgalGaGAvlgalllsrlrrrlss
PF06779         ----------------------------------egqlslsqagliasaNylGYLvGallasfgaaa.gr
PF00083         ----------------------------------------vlsglivssflvgaliGslfaglladrfGR
PF00083         ----------------------------------------vlsglivssflvgaliGslfaglladrfGR


                         -         -         *         -         -         -         -:140
query           IRVFAAFASLASLVILVHSIFINPYVWFILRVLTGISMVCIYTVAESWLNDRSSNKNRGSILSIYMVILY
PF07690         Grrrvlllglllfalglllll.fasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralglls
PF07690         Grrrvlllglllfalglllll.fasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralglls
PF05977         erlvllaavalAlvllslalssslwvavlvlllgGaaWiaalstlnvavqlavprWvrgRalsvYltvla
PF05977         erlvllaavalAlvllslalssslwvavlvlllgGaaWiaalstlnvavqlavprWvrgRalsvYltvla
PF06779         erlvllagllatvllllamaltesfaav------------------------------------------
PF00083         kksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyql
PF00083         kksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyql


                         +         -         -         -         -         *         -:210
query           GSMGIGMFLLNFSRPENYQPFILVSIITSLALIPILLTKKKPPTFKKIQGMPLKELYETSPFGMVSALFY
PF07690         agfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkelaafla
PF07690         agfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkelaafla
PF05977         GglaaGsll-------------------------------------------------------------
PF05977         GglaaGsll-------------------------------------------------------------
PF06779         ----------------------------------------------------------------------
PF00083         aitvGilvaaiiglglnktsnadgwrillglql-------------------------------------
PF00083         aitvGilvaaiiglglnktsnadgwrillglql-------------------------------------


                         -         -         -         +         -         -         -:280
query           GTIQSALFTLLAVYAASMNFTIFQISLVTFLLAISGAISQYPIGKLSDKYDRRKVIIISTFGASLFALLA
PF07690         alarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglll
PF07690         alarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalglll
PF05977         ------------------------atLPifllsl.......laGvlaDnldrRkvllvvqlllllasvll
PF05977         ------------------------atLPifllsl.......laGvlaDnldrRkvllvvqlllllasvll
PF06779         ----------------------------------------------------------------------
PF00083         ------knfglltsksakeessvlsglivssflvgaliGslfaglladrfGRkksllvalvlfvigavlq
PF00083         ------knfglltsksakeessvlsglivssflvgaliGslfaglladrfGRkksllvalvlfvigavlq


                         -         *         -         -         -         -         +:350
query           ILSSGQMYLPGELATSKVWFFIFLILFSICSLPMFSLICAHTNDYIPKEKFVAAGAGIQFTFGLGAMSGP
PF07690         llfa..........sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailg
PF07690         llfa..........sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailg
PF05977         tvlaalgl.......lspwlllaltfllgiGaalnapaWqasvgelvkrddvpaAvaLnsvgvNiaRsvG
PF05977         tvlaalgl.......lspwlllaltfllgiGaalnapaWqasvgelvkrddvpaAvaLnsvgvNiaRsvG
PF06779         ----------------------------------------------------------------------
PF00083         aaakak----------------------------------------------------------------
PF00083         aaakak----------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FLCSIFMNIVGSNGFFVFLLFFHALIGVFGIYRMRVRETVENPDSQFVAMPSTITPAGIELNPTTEHIDE
PF07690         pllggllasslgWravFlilailsllaavlvllllprepperk---------------------------
PF07690         pllggllasslgWravFlilailsllaavlvllllprepperk---------------------------
PF05977         PAlgGvlvaavgaalafavnalsylavivalarwkrev--------------------------------
PF05977         PAlgGvlvaavgaalafavnalsylavivalarwkrev--------------------------------
PF06779         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PYSDKVKEILDRKGVEYKKN--------------------------------------------------
PF07690         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF06779         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------