[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21520.1


[Show Plain Result]

## Summary of Sequence Search
   1::794
 144::392  PF03176 0.0% 21.7391304347826  MMPL family 
 581::788  PF03176 0.0% 20.1923076923077  MMPL family 
 255::392  PF12349 0.0% 20.5882352941176  Sterol-sensing domain of SREBP cleavage-activation 
 659::784  PF12349 0.0% 23.2  Sterol-sensing domain of SREBP cleavage-activation 
   1::794


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSLFYQNIVLKNPKSIFILLLITLLSFGYFSKDFRLDASSDTLLIEGDPDLEYLKEVTERYGSKEFLIL
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TYSPNEGMVTESSINNLLSLKYKIQSLDWVHSVITLLDIPLLNNSEAPLQERLESFKTLKDEGVDTERGF
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NEILNSPVFRNFVISEDGKTSGIIVYIKKDELKDIENKSAQEIEEYKDTLKKKNHENITQIREVIKTYGD
PF03176         ---lsdpdvaaafvSkDgkaaralvtlegdpgsteadesvaairaaveear................ple
PF03176         ---lsdpdvaaafvSkDgkaaralvtlegdpgsteadesvaairaaveear................ple
PF12349         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VGKIYLGGIPMITDDMMSFIKSDIIVFGLGVLLFIIATLWFIFRKLIWIIVPISSCFFSVLIMTGLLGLL
PF03176         glkvevtGpaatladlrdasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaalglvlil
PF03176         glkvevtGpaatladlrdasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaalglvlil
PF12349         --------------------------------------------kvglalagvvvvllsvasslgllall
PF12349         --------------------------------------------kvglalagvvvvllsvasslgllall


                         -         *         -         -         -         -         +:350
query           GWKVTVISSNFIALMLILTMAMNIHMSTRFLQLREDFPNLDNLKIIIMTTSKMFWPIIYTVLTTICAFLS
PF03176         alllglelstfvlgllvvlliavGtDYallLvsRy...reelaagedreeaviravastgkvvtaaGltv
PF03176         alllglelstfvlgllvvlliavGtDYallLvsRy...reelaagedreeaviravastgkvvtaaGltv
PF12349         glkltliileviPflvlavGvdnmfllvkavqrtskslsv..eeriaealgevgpsilltsltellafli
PF12349         glkltliileviPflvlavGvdnmfllvkavqrtskslsv..eeriaealgevgpsilltsltellafli


                         -         -         -         -         *         -         -:420
query           LVFSGIKPIIDFGWMMTLGLITSFIITFTLLPTLLSFMSSNKVKIKEDADSKITSFFGKISINNKSIIFL
PF03176         aiamlgLvvarlpvlaqvGvaialGvlvdvlivlTllPAllv----------------------------
PF03176         aiamlgLvvarlpvlaqvGvaialGvlvdvlivlTllPAllv----------------------------
PF12349         galtpmpavqeFclfaavavlfdFllqitfFvavLsldirre----------------------------
PF12349         galtpmpavqeFclfaavavlfdFllqitfFvavLsldirre----------------------------


                         -         -         +         -         -         -         -:490
query           VTGLVVVLSVVGISKLEVENSFINYFNKNTEIYKGMKLIDEKLGGTTPLEVILKFPENIIVETTEDDEFE
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SWDDEGSKDDEKYWFTKDKIEKIQNVHNYLDNLPAVGKVLSFSSIIEVATQLNNNKPLGTLEMGVLYSKI
PF03176         ----------------------------------------------------------------------
PF03176         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PETIKKDIIDPYISIKDNEARISLRIIDSQDGLRRNDLINQINYDLENELKLSKEEFKLAGVLILFNNLL
PF03176         --------------------ralvtlegdpgsteadesvaairaaveearpleglkvevtGpaatladlr
PF03176         --------------------ralvtlegdpgsteadesvaairaaveearpleglkvevtGpaatladlr
PF12349         ----------------------------------------------------------------------
PF12349         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           QSLFKSQILTLGLVMVGIFAMFMILFRNFKLSLIGVVPNFIAAFFILGIIGLLGIPLDMMTITIAAITIG
PF03176         dasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaalglvlilalllglelstfvlgllv
PF03176         dasdrdlklievvtlvvilviLlivyrSlvaallplltvvvsllaalglvlilalllglelstfvlgllv
PF12349         ----------------------------vglalagvvvvllsvasslgllallglkltliileviPflvl
PF12349         ----------------------------vglalagvvvvllsvasslgllallglkltliileviPflvl


                         -         -         -         -         +         -         -:770
query           IAVDNSIHYIYRFKEEFLKIKDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIYFGVFTGLA
PF03176         vlliavGtDYallLvsRyreelaagedreeaviravastgkvvtaaGltvaiamlgLvvarlpvlaqvGv
PF03176         vlliavGtDYallLvsRyreelaagedreeaviravastgkvvtaaGltvaiamlgLvvarlpvlaqvGv
PF12349         avGvdnmfllvkavqrtskslsv.eeriaealgevgpsilltsltellafligaltpmpavqeFclfaav
PF12349         avGvdnmfllvkavqrtskslsv.eeriaealgevgpsilltsltellafligaltpmpavqeFclfaav


                         -         -         *         -         -         -         -:840
query           MLLAMISVLTLLPSLILISKPFGK----------------------------------------------
PF03176         aialGvlvdvlivlTllP----------------------------------------------------
PF03176         aialGvlvdvlivlTllP----------------------------------------------------
PF12349         avlfdFllqitfFv--------------------------------------------------------
PF12349         avlfdFllqitfFv--------------------------------------------------------