[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21535.1


[Show Plain Result]

## Summary of Sequence Search
   1::485
 170::477  PF00883 0.0% 49.5081967213115  Cytosol aminopeptidase family, catalytic domain 
   1::485


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTIQINYKKISSKKDLANLVLFVDEKFNINNLKKYLSNLEFSYISDLLKNSDLKKDLLSFEVNSKKTVFL
PF00883         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VSIKKDIKISDIENLGAKFHSYINNDKKKEYFVNSDTINNKIKNFVGYFLHGLKLKSYEFNIYKSKKNKE
PF00883         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TVLINVIGNKNKISIQDHLRFKALEEGSFFARDLVSEPGNVLHPDEYAKRINTLKKFGLKINIYDEKKLK
PF00883         -----------------------------larelvntPaniltpaelaeeakklaekasvkvevldeeel


                         -         -         -         +         -         -         -:280
query           KLGMNALLGVGQGSIRGSYLVTMEWNGAKNNSNPLAFVGKGVCFDTGGYSLKPAKFMEDMTYDMAGSATV
PF00883         eelgmgallaVakgseneprlvvleykgkkseekkklaLvGKgitfDsGGlsiKpaasmeemkaDmgGaa


                         -         *         -         -         -         -         +:350
query           VGLMKNLAIRKAKINAVGVVGLVENMVSGNAQRPGDIVKSYSGKTIEVLNTDAEGRLVLADALTFTEKKF
PF00883         avlgalkalaklklevnvvavvalteNlisgkaqkpgdvltalnGktvevnNTDAEGRLvLaDalvyake


                         -         -         -         -         *         -         -:420
query           KPKFMVDLATLTGAIIVSLGSEYAGLFSNDDKLSKQLLEAGDKVEEKLWRMPLHKNFDKLIDSKNADMQN
PF00883         .lkaeaiidvaTLTGavvvalgeeitgifsnsdelakelikaaeesgekvwrlpleeeykkqlkskvAdl


                         -         -         +         -         -         -         -:490
query           INYVGGAGSTTAAQFLQRFILNKTPWAHLDIAGMAFSKYGGALNSGGATSYGVRLLNQLIEDNYE-----
PF00883         aNigkaegagaitAalFlkefveekevkwlHlDiagtaekekkka..skgatGvgvr-------------