[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21597.1


[Show Plain Result]

## Summary of Sequence Search
   1::281
  73::277  PF01557 0.0% 45.8128078817734  Fumarylacetoacetate (FAA) hydrolase family 
   1::281


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDINLENLEEVNQNERIGSCISKP
PF01557         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
PF01557         --iiavglnyaehaeeagsagleppdsgvplepvfflkppsslvgpgtpirrPagsrkldyEvELavvig


                         +         -         -         -         -         *         -:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQDVNNLNLTLDVNGHRHQT
PF01557         kplgevltaeealdaiagytlanDvsaRdlqgeealplgwflaksfdtfapiGpwivtpdelgdpadlal


                         -         -         -         +         -         -         -:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIVTTGTPPGVGLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILE
PF01557         rlrvngelvqrsstsdlifspaqliahlsrgltLepGdlvltGTpsgvg.afetlrflqpgDtveve---


                         -         *         -         -         -         -         +:350
query           Q---------------------------------------------------------------------
PF01557         ----------------------------------------------------------------------