[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21647.1


[Show Plain Result]

## Summary of Sequence Search
   1::406
  20::322  PF07690 0.0% 20.4697986577181  Major Facilitator Superfamily 
 324::393  PF07690 0.0% 26.0869565217391  Major Facilitator Superfamily 
  47::129  PF00083 0.0% 24.0963855421687  Sugar (and other) transporter 
 124::191  PF00083 0.0% 26.4705882352941  Sugar (and other) transporter 
 226::391  PF00083 0.0% 21.3414634146341  Sugar (and other) transporter 
   1::406


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSEKFIQNKTALITLIAACIVVLISLGVRQTFGLFFMDFKNDLDISITQSGLAIGIQMLMWGLTGPIFG
PF07690         -------------------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiaslla
PF07690         -------------------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiaslla
PF00083         ----------------------------------------------ssvlsglivssflvgaliGslfag
PF00083         ----------------------------------------------ssvlsglivssflvgaliGslfag
PF00083         ----------------------------------------------ssvlsglivssflvgaliGslfag


                         -         -         *         -         -         -         -:140
query           AIADKYGGHKAICLAFVFYILGIYFLYAGPNTGIFFQIDLGLLVGIGLGGTAISIPMSIVGKHFPLSNRT
PF07690         GrlsdrfGrrrvlllglllfalglllllfa...sslwalllvlrvlqGlga.galfpagaaliadwfpke
PF07690         GrlsdrfGrrrvlllglllfalglllllfa...sslwalllvlrvlqGlga.galfpagaaliadwfpke
PF00083         lladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlispvpwvlvsElfpqsvRp
PF00083         lladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlispvpwvlvsElfpqsvRp
PF00083         lladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlispvpwvlvsElfpqsvRp


                         +         -         -         -         -         *         -:210
query           IAMSIVTAVGSLGYFISPLYTSYSLIKNGWVDTLFVFTIFLFIGLIIAFFVRSPSAAQSIEKPNNQSAIE
PF07690         ergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaee
PF07690         ergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaee
PF00083         kalaiavaanwlanfligllfpiiteaigggyvflvfagllvlfilfvfff-------------------
PF00083         kalaiavaanwlanfligllfpiiteaigggyvflvfagllvlfilfvfff-------------------
PF00083         kalaiavaanwlanfligllfpiiteaigggyvflvfagllvlfilfvfff-------------------


                         -         -         -         +         -         -         -:280
query           AFKEAFKNKSYILLVSGFFVCGFHITLVGTHVPKYVIDRGLESWTAAAILSLIGLFNIFGSLLSGYLSTK
PF07690         lrkepaplvpawklllkppvlw.llialllfffvfsglltllplylqevlglspglllaglllgllalig
PF07690         lrkepaplvpawklllkppvlw.llialllfffvfsglltllplylqevlglspglllaglllgllalig
PF00083         ---------------gg.flfGYdtgvigatltlikfaknfglltsksakeessvlsglivssflvgali
PF00083         ---------------gg.flfGYdtgvigatltlikfaknfglltsksakeessvlsglivssflvgali
PF00083         ---------------gg.flfGYdtgvigatltlikfaknfglltsksakeessvlsglivssflvgali


                         -         *         -         -         -         -         +:350
query           ISKKIILSSIYALRGISIILFIFLPASNINAFIFGASFGFLWLSTVPATSGIVAHIFGTKYLGILYGIVF
PF07690         aigalllgrlsdrlgrrrrlllallllllaalglallaftss-alfpagaaliadwfpkeergralglls
PF07690         aigalllgrlsdrlgrrrrlllallllllaalglallaftss-alfpagaaliadwfpkeergralglls
PF00083         GslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiA
PF00083         GslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiA
PF00083         GslfaglladrfGRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiA


                         -         -         -         -         *         -         -:420
query           LSHQVGSFFGAFLGGLFHDLYGSYDYAWYLAIVLSIFAAIIHLPIKEEAVLRLKIE--------------
PF07690         agfslGailgpllggllasslg.WravFlilailsllaavlvl---------------------------
PF07690         agfslGailgpllggllasslg.WravFlilailsllaavlvl---------------------------
PF00083         pkklrgalgslyqlaitvGilvaaiiglgl.nktsnadgwr-----------------------------
PF00083         pkklrgalgslyqlaitvGilvaaiiglgl.nktsnadgwr-----------------------------
PF00083         pkklrgalgslyqlaitvGilvaaiiglgl.nktsnadgwr-----------------------------