[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21667.1


[Show Plain Result]

## Summary of Sequence Search
   1::204
  25::192  PF00657 0.0% 22.8915662650602  GDSL-like Lipase/Acylhydrolase 
   1::204


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKRFIIKIIAVCLVSINVNALENVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGST
PF00657         ------------------------ivafGDSltdgggdsngggwvaglanrltsanrlnqkppgvdvfnr


                         -         -         *         -         -         -         -:140
query           SAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGIS
PF00657         gisGrtsdgrlvrlksqalnllqelkkllpkkdykspdlvtidiGtNDlitaeslkqdqnasvpefldnl


                         +         -         -         -         -         *         -:210
query           YKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSIINFIKK------
PF00657         rsllkrly.legarlivlltfvlhnlgplgalasarskkkdakgclerlnea------------------