[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21725.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
 146::228  PF08436 0.0% 59.0361445783133  1-deoxy-D-xylulose 5-phosphate reductoisomerase C-t 
   4::130  PF02670 0.0% 36.5079365079365  1-deoxy-D-xylulose 5-phosphate reductoisomerase 
   3::60   PF01118 0.0% 26.3157894736842  Semialdehyde dehydrogenase, NAD binding domain 
   4::79   PF05368 0.0% 26.7605633802817  NmrA-like family 
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYNSFLITTKLLK
PF08436         ----------------------------------------------------------------------
PF02670         ---vviLGsTGSIGtqtLdvieknpdkfevvalaagsnvellaeqakefkpklvavadeeaakelkealk
PF01118         --kvaivGatGyvGqellrlLee.hpelelvalvassrsaGkklaeahkaleegkdlvle----------
PF05368         ---ilviGaTGqqGksvvraslk..aghkvralvRdl.kselakslkaaGvelv.egdlddkeslvealk


                         -         -         *         -         -         -         -:140
query           NAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIICGWNLIKKDLKK
PF08436         ----------------------------------------------------------------------
PF02670         ekelktevlaGeealkelaee.eeadvvvnaivGaaGLkptlaaikagkriaLANKEsLV----------
PF01118         ----------------------------------------------------------------------
PF05368         gvdv.vfsv-------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFRNLSLKKFRNISVKDALKHPNWSMGKKITID
PF08436         -----lPvDsEHsaifqlleeekkkevekliltasGgpfrkkeleelkkvtveealkHPnWkmGkkitid
PF02670         ----------------------------------------------------------------------
PF01118         ----------------------------------------------------------------------
PF05368         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SATMMNKVFEIIEAKKIFNLNYKQLEILIHPKSYLHAIVKFNNGLSKLLVHDTNMTIPIFNSIYFNTDKK
PF08436         satlvnkglEviEakllf----------------------------------------------------
PF02670         ----------------------------------------------------------------------
PF01118         ----------------------------------------------------------------------
PF05368         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LKSKNIDIKTLNNLNLKKIDNIRFPVIKILNNLSNEDSLFETIIVSANDKLVKLFLNNKIKFNDISNTLI
PF08436         ----------------------------------------------------------------------
PF02670         ----------------------------------------------------------------------
PF01118         ----------------------------------------------------------------------
PF05368         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KICNTPEFNKFKSMKPRNIDEIQNLNDYVSLKISSMSV--------------------------------
PF08436         ----------------------------------------------------------------------
PF02670         ----------------------------------------------------------------------
PF01118         ----------------------------------------------------------------------
PF05368         ----------------------------------------------------------------------