[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21732.1


[Show Plain Result]

## Summary of Sequence Search
   1::378
   4::369  PF02684 0.0% 31.6939890710383  Lipid-A-disaccharide synthetase 
   1::378


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIFILTGEPSGDKLASTVISKLKMNNPNIEYLSVGGTHIKKLGIKSIFDLKEITYLGFTSVLFNIFKI
PF02684         ---iflsageaSgdilgaelikelkeeypnlrfvGvggekmeaegleslaemeelsvvGlievlkkllkl


                         -         -         *         -         -         -         -:140
query           RKKINKTVEEIIKFNPDILFSVDSPDFTLRVAEKVKNINHNIKIIHYVAPQVWVWRKNRVKKIKKFIDHI
PF02684         lkiykkvvknllkkkadlliliDapdfnlrlakklrkqgikkkiiyyvsPsvWawkpkrakklekyldll


                         +         -         -         -         -         *         -:210
query           LLLFNFEKKYFDEENIKNTFVGHPLIEKKDNVITSLDNLISKDKKIISLFPGSRKSETSVLLPILLNFIK
PF02684         laiLPfEkelfkkkgldvryvGHplldeikkekkeasakellidederilallpgsRkseierlllsllk


                         -         -         -         +         -         -         -:280
query           LMNKKKLDHLFVFHATDENKEFIINKVKKTNLDNIDIISDEDIKNQVLSNSIFAVSKSGTISLQISSANI
PF02684         aaqqlkkqlenlkllvplvskkyeeqieeikaeenlqvsllllsgerlealaaadlaliksGTaaLEaal


                         -         *         -         -         -         -         +:350
query           PSIIIYKLGFINFMIFKLLVNVRFANIINIINDKEVIPELLQKECNAEEIYKTVTYFLKNPELIEKQLVD
PF02684         aktPmvvayrvkpltfflakrlvkikyvSlpNillnreivpeliqeesdaeleaiallllllneekakke


                         -         -         -         -         *         -         -:420
query           CKKTLEGIKSKSSSSSEAALILNNYLVS------------------------------------------
PF02684         kdkerkflelleeeecesk---------------------------------------------------