[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21799.1


[Show Plain Result]

## Summary of Sequence Search
   1::204
  64::170  PF04367 0.0% 44.8598130841121  Protein of unknown function (DUF502) 
   1::204


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIKKKKSFALRLRNYFFTGVIVLIPIGFTLYLSKFLINFSTKLVPSGLNPNTYLPYAIPGIEIILTIIF
PF04367         ---------------------------------------------------------------lllvlll


                         -         -         *         -         -         -         -:140
query           ITVVGGLSLTFIGKKFLQIIDDLFKRMPILRTIYSAIGQMTDSFRAQEGNKKSVVLVEYPRKGSWAVGFA
PF04367         illvGllvsnllgrsllkllerllkriPlvksiYssvkqlvetllgdkkksfkkvvlveyprkgvwalgf


                         +         -         -         -         -         *         -:210
query           TKENTGEIKAKININLVNVFVPTTPNPTSGFLLMIPKDDLIYLDMTFEEASKFIVSAGTSKPKS------
PF04367         vtseekgelkekleeelvaVfvPtspnpts----------------------------------------