[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21850.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
   9::202  PF00926 0.0% 51.0309278350515  3,4-dihydroxy-2-butanone 4-phosphate synthase 
 215::363  PF00925 0.0% 24.8322147651007  GTP cyclohydrolase II 
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKR
PF00926         --------ieeaiealkaGklvivvDdedrEnegdlvvaAeavtpekvafmvrharGlicvalteeraek
PF00925         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRAKTIKIASKKNANKKDIVSPGHVFPIIAKDGGV
PF00926         lgLppmvdkntsekktaftvsvdhakgtttGIsaadRalTirkladekakaedfvrPGhvfplrakeggv
PF00925         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRLKKEKLIK
PF00926         lerrGhTEaavdLarlagltpaaviceildddgsmarleelkefakehglklitiedlieyr--------
PF00925         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LKKQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLN
PF00926         ----------------------------------------------------------------------
PF00925         ----aelptefgefrlvafrdkvdgkehlalvkgdisedepvlVRvHsecltgDvlgslrcdcgeqLdea


                         -         *         -         -         -         -         +:350
query           YFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKV
PF00926         ----------------------------------------------------------------------
PF00925         leriaeegrGvivylrqegrgiglleklraynlqdegldtveanlalglpadeRdygigaqILrdlGvrk


                         -         -         -         -         *         -         -:420
query           IGLEGYDIKITKQEII------------------------------------------------------
PF00926         ----------------------------------------------------------------------
PF00925         irLltnnpekiea---------------------------------------------------------