[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21852.1


[Show Plain Result]

## Summary of Sequence Search
   1::351
   1::93   PF00383 0.0% 49.4117647058824  Cytidine and deoxycytidylate deaminase zinc-binding 
 158::311  PF01872 0.0% 26.4285714285714  RibD C-terminal domain 
   1::351


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCS
PF00383         leialeaakeay..kcsnfkvGavivkkngeiistgyngepaggsktiHAEvnAilsaaknggsklegat
PF01872         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HYGKTPPCTNIIIKNKIKEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLKKQINKFYAPYFFNRKKNL
PF00383         lyvtlePCgm......Cakaiie-----------------------------------------------
PF01872         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
PF00383         ----------------------------------------------------------------------
PF01872         -----------------geskwitgeearadvhelraeadailvGrgtvladnpsltvrwvkkreaeada


                         -         -         -         +         -         -         -:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
PF00383         ----------------------------------------------------------------------
PF01872         earqpvrvVvdstlrvpldakvltdd.aptlvatteeadkekveklk......v.......rvdlkelle


                         -         *         -         -         -         -         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLYKCSKSLSKLVNHKEFGFLKELKKNYKNKLKINKKLGKDVITLY
PF00383         ----------------------------------------------------------------------
PF01872         eLkergirsllveGGatLagsllraglvDel---------------------------------------


                         -         -         -         -         *         -         -:420
query           K---------------------------------------------------------------------
PF00383         ----------------------------------------------------------------------
PF01872         ----------------------------------------------------------------------