[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21934.1


[Show Plain Result]

## Summary of Sequence Search
   1::247
  99::237  PF00588 0.0% 31.8840579710145  SpoU rRNA Methylase family 
   7::80   PF08032 0.0% 39.3939393939394  RNA 2'-O ribose methyltransferase substrate binding 
   1::247


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQI
PF00588         ----------------------------------------------------------------------
PF08032         ------lieGlhaVeeALksgpr.iekllvteg.radkrleeilklakkk....gikvqlvsekvLdkls


                         -         -         *         -         -         -         -:140
query           MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLM
PF00588         ----------------------------ivvldeiedpgNlGaiaRtaaafgaselilvkprsvdllnkk
PF08032         g..tvnHQGv------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGK
PF00588         akrasagalellelkvvdsleealkdlkeeglkviatsl.kgkslreielkekvalvfGnEdkGlsnell
PF08032         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YTDFFVKIDINKDVESLNISNSAAIVFHHLSYLKKNS---------------------------------
PF00588         ekadelvkIpmsgeveSLNvavAvail-------------------------------------------
PF08032         ----------------------------------------------------------------------