[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21946.1


[Show Plain Result]

## Summary of Sequence Search
   1::110
  18::82   PF00462 0.0% 41.6666666666667 PF00462 Glutaredoxin 
  98::109  PF00462 0.0% 25 PF00462 Glutaredoxin 
   1::110


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
PF00462         -----------------vvvftk.....ptCpyCkkakrlLdelgvkyeeidvdedpeireelkelsgwr
PF00462         -----------------vvvftk.....ptCpyCkkakrlLdelgvkyeeidvdedpeireelkelsgwr


                         -         -         *         -         -         -         -:140
query           TIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKK------------------------------
PF00462         tvPqvfidgehi---------------krlLdelgvkye-------------------------------
PF00462         tvPqvfidgehi---------------krlLdelgvkye-------------------------------